6Y2D: Second KH domain of FUBP1

Crystal structure of the second KH domain of FUBP1. Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Mar 2020.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,215
Mol. weight: 33.8 kDa
Released: 25 Mar 2020

Explore 6Y2D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Y2D contains 20 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	186-192	7	1
α-helix	194-196	3
α-helix	197-201	5
α-helix	203-205	3
α-helix	206-215	10
β-strand	218-221	4	1
β-strand	233-239	7	1
α-helix	241-255	15

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	186-192	7	2
α-helix	194-196	3
α-helix	207-215	9
β-strand	218-221	4	2
β-strand	233-239	7	2
α-helix	241-256	16

Chain D: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	186-192	7	1
α-helix	193	1
α-helix	194-196	3
α-helix	197-201	5
α-helix	203-205	3
α-helix	206-215	10
β-strand	218-221	4	1
α-helix	225-227	3
β-strand	233-239	7	1
α-helix	241-255	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Far upstream element-binding protein 1	A, B, C, D	protein	77	Homo sapiens	Q96AE4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6Y2D_1 Far upstream element-binding protein 1 (chains A, B, C, D)
SMNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPY
KVQQAKEMVLELIRDQG

Primary citation

Comparative structural analyses and nucleotide-binding characterization of the four KH domains of FUBP1. Ni, X., Knapp, S., Chaikuad, A. Sci Rep (2020) 10:13459-13459. DOI 10.1038/s41598-020-69832-z · PubMed

Other PDB entries of the same protein (UniProt Q96AE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LIJ 1.8 Å, Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo…
6Y24 1.86 Å, Crystal structure of fourth KH domain of FUBP1
6Y2C 2.0 Å, Crystal structure of the third KH domain of FUBP1
1J4W Complex of the KH3 and KH4 domains of fbp with a single_stranded 29mer DNA…
2KXH Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox…
8P25 Solution structure of a chimeric U2AF2 RRM2 / FUBP1 N-Box

Browse structure collections

About this viewer

MolViewer shows 6Y2D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.