6Y38: Whirlin PDZ3

Crystal structure of Whirlin PDZ3 in complex with Myosin 15a C-terminal PDZ binding motif peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 7 Oct 2020.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 4
Atoms: 1,833
Mol. weight: 25 kDa
Released: 7 Oct 2020

Explore 6Y38 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Y38 contains 6 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	813-819	7	1
β-strand	827-830	4	1
β-strand	841-845	5	1
α-helix	850-854	5
β-strand	862-866	5	1
β-strand	869-870	2	1
α-helix	876-887	12
β-strand	894-900	7	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	813-819	7	2
β-strand	827-830	4	2
β-strand	841-845	5	2
α-helix	850-854	5
β-strand	862-866	5	2
β-strand	869-870	2	2
α-helix	876-888	13
β-strand	894-900	7	2

Chains C and D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3502	1	2
α-helix	3504-3507	4
β-strand	3508-3510	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Whirlin	A, B	protein	102	Mus musculus	Q80VW5 (AlphaFold model)
Chains: C,D	C, D	protein	13	Mus musculus	Q9QZZ4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6Y38_1 Whirlin (chains A, B)
GAMGSTSLEPTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGH
VILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFN

Sequence of entity 2 (C, D), FASTA

>6Y38_2 Chains: C,D (chains C, D)
ERLTLPPSEITLL

Primary citation

Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners. Zhu, Y., Delhommel, F., Cordier, F. et al. J Mol Biol (2020) 432:5920-5937. DOI 10.1016/j.jmb.2020.09.012 · PubMed

Other PDB entries of the same protein (UniProt Q80VW5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y9Q 1.31 Å, Crystal structure of Whirlin PDZ3_C-ter in complex with Taperin internal PDZ binding…
6Y9O 1.63 Å, Crystal structure of Whirlin PDZ3_C-ter in complex with CASK internal PDZ binding motif…
6FDD 1.75 Å, Crystal Structure of the HHD2 Domain of Whirlin
6FDE 1.85 Å, Crystal Structure of the HHD2 Domain of Whirlin : 3-helix conformation
6Y9N 1.93 Å, Crystal structure of Whirlin PDZ3_C-ter in complex with Myosin 15a C-terminal PDZ…
6Y9P 3.17 Å, Crystal structure of Whirlin PDZ3_C-ter in complex with Harmonin a1 C-terminal PDZ…

Browse structure collections

About this viewer

MolViewer shows 6Y38 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.