Crystal structure of Whirlin PDZ3_C-ter in complex with Myosin 15a C-terminal PDZ binding motif peptide. Determined by X-ray diffraction at 1.93 Å resolution. Released 7 Oct 2020.
Explore 6Y9N in 3D Show helices and sheets RCSB PDB PDBe
6Y9N contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 814-819 | 6 | 1 |
| β-strand | 827-830 | 4 | 1 |
| β-strand | 841-845 | 5 | 1 |
| α-helix | 850-854 | 5 | |
| β-strand | 862-866 | 5 | 1 |
| β-strand | 869-870 | 2 | 1 |
| α-helix | 876-888 | 13 | |
| β-strand | 894-900 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3508-3510 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Whirlin | A | protein | 105 | Mus musculus | Q80VW5 (AlphaFold model) |
| Unconventional myosin-XV | B | protein | 13 | Mus musculus | Q9QZZ4 (AlphaFold model) |
>6Y9N_1 Whirlin (chains A) GAMGSTSLEPTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGH VILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVML
>6Y9N_2 Unconventional myosin-XV (chains B) ERLTLPPSEITLL
Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners. Zhu, Y., Delhommel, F., Cordier, F. et al. J Mol Biol (2020) 432:5920-5937. DOI 10.1016/j.jmb.2020.09.012 · PubMed
Other PDB entries of the same protein (UniProt Q80VW5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Y9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.