6YVR: Neurotensin receptor 1

Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist NTS8-13. Determined by X-ray diffraction at 2.46 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.46 Å
Organisms: Rattus norvegicus, synthetic construct
Chains: 4
Atoms: 7,350
Mol. weight: 110.5 kDa
Ligands: BNG
Released: 10 Feb 2021

Explore 6YVR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YVR contains 54 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains AAA and BBB: 27 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	53-55	3
α-helix	61-90	30
α-helix	97-115	19
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	138-172	35
α-helix	174-180	7
α-helix	183-200	18
α-helix	203-207	5
β-strand	208-212	5	1
α-helix	220-222	3
β-strand	223-227	5	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-269	22
α-helix	297-333	37
α-helix	336-338	3
α-helix	341-370	30
α-helix	372-391	20
α-helix	394-403	10
α-helix	417-424	8
α-helix	427-435	9
α-helix	450-457	8
α-helix	460-468	9
α-helix	483-489	7
α-helix	493-501	9
α-helix	516-522	7
α-helix	526-542	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1,Neurotensin receptor type 1,DARPin crystallisation chaperone	AAA, BBB	protein	482	Rattus norvegicus, synthetic construct	P20789 (AlphaFold model)
neurotensin NTS8-13 (full agonist)	CCC, DDD	protein	8	Rattus norvegicus

Sequence of entity 1 (AAA, BBB), FASTA

>6YVR_1 Neurotensin receptor type 1,Neurotensin receptor type 1,DARPin crystallisation chaperone (chains AAA, BBB)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSLQSRVDYY
LGSLALSDLLILLFALPVDLYNFIWVHHPWAFGDAGCKGYYFLREACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQAAFNMTIEPGRVQAL
RRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDEQWTTALFDFYHYFYMLSNALVYVSAA
INPILYNLAEDLVEDWEKARKLLEAARKGQDDEVRILLANGADVNTADETGFTPLHLAAW
EGHLGIVEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEVLLKNGAGVNATDVIGTAP
LHLAAMWGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAATRELEVL
FQ

Sequence of entity 2 (CCC, DDD), FASTA

>6YVR_2 neurotensin NTS8-13 (full agonist) (chains CCC, DDD)
GGRRPYIL

Ligands and cofactors

ID	Name	Formula	Copies
BNG	nonyl beta-D-glucopyranoside	C15 H30 O6	8

Primary citation

Complexes of the neurotensin receptor 1 with small-molecule ligands reveal structural determinants of full, partial, and inverse agonism. Deluigi, M., Klipp, A., Klenk, C. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abe5504 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6ZIN 2.64 Å, Crystal structure of the neurotensin receptor 1 in complex with the small molecule…
6Z4S 2.71 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6Z8N 2.8 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full…
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator
4XEE 2.9 Å, Structure of active-like neurotensin receptor

Browse structure collections

About this viewer

MolViewer shows 6YVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.