6Z4S: Neurotensin receptor 1

Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small molecule inverse agonist SR48692. Determined by X-ray diffraction at 2.71 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.71 Å
Organisms: Rattus norvegicus, synthetic construct
Chains: 1
Atoms: 3,330
Mol. weight: 53.74 kDa
Ligands: Q6Q
Released: 10 Feb 2021

Explore 6Z4S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z4S contains 24 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 24 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	61-90	30
α-helix	97-115	19
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	138-172	35
α-helix	174-179	6
α-helix	183-200	18
α-helix	204-207	4
β-strand	208-211	4	1
β-strand	224-227	4	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-269	22
α-helix	299-332	34
α-helix	341-391	51
α-helix	394-402	9
α-helix	417-424	8
α-helix	427-435	9
α-helix	450-457	8
α-helix	460-468	9
α-helix	483-489	7
α-helix	493-501	9
α-helix	516-522	7
α-helix	526-536	11
α-helix	538-544	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1,DARPin,HRV 3C protease recognition sequence	AAA	protein	482	Rattus norvegicus, synthetic construct	P20789 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>6Z4S_1 Neurotensin receptor type 1,DARPin,HRV 3C protease recognition sequence (chains AAA)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSLQSRVDYY
LGSLALSDLLILLFALPVELYNFIWVHHPWAFGDAGCKGYYFLRDACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQAAFNMTIEPGRVQAL
RRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDEQWTTALFDFYHYFYMLSNALFYVSSA
INPILYNLAEDLVEDWEKARKLLEAARKGQDDEVRILLANGADVNTADETGFTPLHLAAW
EGHLGIVEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEVLLKNGAGVNATDVIGTAP
LHLAAMWGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAATRELEVL
FQ

Ligands and cofactors

ID	Name	Formula	Copies
Q6Q	2-[[1-(7-chloranylquinolin-4-yl)-5-(2,6-dimethoxyphenyl)pyrazol-3-yl]carbonylam…	C32 H31 Cl N4 O5	1

Primary citation

Complexes of the neurotensin receptor 1 with small-molecule ligands reveal structural determinants of full, partial, and inverse agonism. Deluigi, M., Klipp, A., Klenk, C. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abe5504 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YVR 2.46 Å, Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist…
8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6ZIN 2.64 Å, Crystal structure of the neurotensin receptor 1 in complex with the small molecule…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6Z8N 2.8 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full…
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator
4XEE 2.9 Å, Structure of active-like neurotensin receptor

Browse structure collections

About this viewer

MolViewer shows 6Z4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.