6ZIN: Neurotensin receptor 1

Crystal structure of the neurotensin receptor 1 in complex with the small molecule inverse agonist SR48692. Determined by X-ray diffraction at 2.64 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.64 Å
Organisms: Rattus norvegicus, synthetic construct
Chains: 1
Atoms: 3,159
Mol. weight: 53.68 kDa
Ligands: Q6Q
Released: 10 Feb 2021

Explore 6ZIN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZIN contains 21 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 21 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	62-91	30
α-helix	97-115	19
α-helix	116-120	5
α-helix	121-129	9
α-helix	138-172	35
α-helix	174-177	4
α-helix	183-200	18
α-helix	204-207	4
β-strand	208-211	4	1
β-strand	224-227	4	1
α-helix	231-244	14
α-helix	248-268	21
α-helix	298-333	36
α-helix	344-391	48
α-helix	394-403	10
α-helix	417-424	8
α-helix	427-435	9
α-helix	450-456	7
α-helix	460-468	9
α-helix	483-490	8
α-helix	493-501	9
α-helix	516-522	7
α-helix	526-543	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1,DARPin,HRV 3C protease recognition sequence	AAA	protein	482	Rattus norvegicus, synthetic construct	P20789 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>6ZIN_1 Neurotensin receptor type 1,DARPin,HRV 3C protease recognition sequence (chains AAA)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSLQSRVDYY
LGSLALSDLLILLFALPVDLYNFIWVHHPWAFGDAGCKGYYFLREACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQAAFNMTIEPGRVQAL
RRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDEQWTTALFDFYHYFYMLSNALVYVSAA
INPILYNLAEDLVEDWEKARKLLEAARKGQDDEVRILLANGADVNTADETGFTPLHLAAW
EGHLGIVEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEVLLKNGAGVNATDVIGTAP
LHLAAMWGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAATRELEVL
FQ

Ligands and cofactors

ID	Name	Formula	Copies
Q6Q	2-[[1-(7-chloranylquinolin-4-yl)-5-(2,6-dimethoxyphenyl)pyrazol-3-yl]carbonylam…	C32 H31 Cl N4 O5	1

Primary citation

Complexes of the neurotensin receptor 1 with small-molecule ligands reveal structural determinants of full, partial, and inverse agonism. Deluigi, M., Klipp, A., Klenk, C. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abe5504 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YVR 2.46 Å, Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist…
8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6Z4S 2.71 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6Z8N 2.8 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full…
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator
4XEE 2.9 Å, Structure of active-like neurotensin receptor

Browse structure collections

About this viewer

MolViewer shows 6ZIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.