Structure of M1-StaR-T4L in complex with 77-LH-28-1 at 2.17A. Determined by X-ray diffraction at 2.17 Å resolution. Released 6 Oct 2021.
Explore 6ZFZ in 3D Show helices and sheets RCSB PDB PDBe
6ZFZ contains 25 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-52 | 31 | |
| α-helix | 54-56 | 3 | |
| α-helix | 59-73 | 15 | |
| α-helix | 74-78 | 5 | |
| α-helix | 79-88 | 10 | |
| α-helix | 95-128 | 34 | |
| α-helix | 133-135 | 3 | |
| α-helix | 139-168 | 30 | |
| α-helix | 174 | 1 | |
| α-helix | 186-193 | 8 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-1010 | 30 | |
| β-strand | 1014-1015 | 2 | 1 |
| β-strand | 1016 | 1 | 2 |
| β-strand | 1017-1019 | 3 | 1 |
| β-strand | 1025-1028 | 4 | 1 |
| β-strand | 1031-1034 | 4 | 1 |
| α-helix | 1039-1050 | 12 | |
| β-strand | 1057 | 1 | 2 |
| α-helix | 1060-1080 | 21 | |
| α-helix | 1085-1090 | 6 | |
| α-helix | 1093-1112 | 20 | |
| α-helix | 1115-1122 | 8 | |
| α-helix | 1126-1134 | 9 | |
| α-helix | 1137-1141 | 5 | |
| α-helix | 1143-1155 | 13 | |
| α-helix | 355-357 | 3 | |
| α-helix | 362-390 | 29 | |
| α-helix | 397-408 | 12 | |
| α-helix | 410-421 | 12 | |
| α-helix | 423-437 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 | A | protein | 455 | Homo sapiens, Enterobacteria phage T4 | P00720, P11229 (AlphaFold model) |
>6ZFZ_1 Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A) METVEMVAIATVAGLLSLATVTGNILLMLSIKVNRQLQTVNNYFAFSLACADLIIGAFSM NLYTVYIIMGHWALGALACDLALALDYVASNAAVMNLLLISFDRYFSVTRPLSYRAKRTP RRALLMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMATFYL PVTVMCTLYWRIYRETENRANIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNA AKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALIN MVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY TFSLVKEKAALRTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNATI NPMCYALCNKAFRDTFRLLLLARWDHHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| QJT | 1-[3-(4-butylpiperidin-1-yl)propyl]-3,4-dihydroquinolin-2-one | C21 H32 N2 O | 1 |
| OLA | Oleic acid | C18 H34 O2 | 8 |
| PO4 | Phosphate ion | O4 P | 1 |
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 1 |
Water and common crystallization additives (EPE, PGE) are not listed.
From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease. Brown, A.J.H., Bradley, S.J., Marshall, F.H. et al. Cell (2021) 184:5886. DOI 10.1016/j.cell.2021.11.001 · PubMed
Other PDB entries of the same protein (UniProt P00720), best resolution first:
MolViewer shows 6ZFZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.