7C1M: Nanobody binder from SSO7d library

Complex structure of tyrosinated alpha-tubulin carboxy-terminal peptide and A1aY1 binder. Determined by solution NMR. Released 2 Sept 2020.

Method: Solution NMR
Organisms: Saccharolobus solfataricus 98/2, Homo sapiens
Chains: 2
Atoms: 600
Mol. weight: 8.84 kDa
Released: 2 Sept 2020

Explore 7C1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7C1M contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	14-19	6	1
β-strand	23-28	6	2
β-strand	32-40	9	2
β-strand	43-50	8	2
α-helix	56-64	9
β-strand	66	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nanobody binder from SSO7d library	A	protein	67	Saccharolobus solfataricus 98/2
Carboxy-terminal peptide from tyrosinated alpha-tubulin	B	protein	12	Homo sapiens	Q71U36 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7C1M_1 Nanobody binder from SSO7d library (chains A)
GSHMATVKFKYKGEEKQVDISKILSVGRYGKLIHFLYDLGGGKAGMGMVSEKDAPKELLQ
MLEKQKK

Sequence of entity 2 (B), FASTA

>7C1M_2 Carboxy-terminal peptide from tyrosinated alpha-tubulin (chains B)
VEGEGEEEGEEY

Primary citation

Genetically encoded live-cell sensor for tyrosinated microtubules. Kesarwani, S., Lama, P., Chandra, A. et al. J Cell Biol (2020) 219. DOI 10.1083/jcb.201912107 · PubMed

Other PDB entries of the same protein (UniProt Q71U36 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9WD9 2.26 Å, GMPCPP-stabilized human alpha1A/beta3 S239C microtubule
6J8F 2.28 Å, Crystal structure of SVBP-VASH1 with peptide mimic the C-terminal of alpha-tubulin
9WD7 2.34 Å, GMPCPP-stabilizsd human alpha1A/beta3 microtubule
9WDA 2.35 Å, Paclitaxel/GMPCPP-stabilized human alpha1A/beta3 microtubule
9WDB 2.39 Å, Paclitaxel/GMPCPP-stabilized human alpha1A/beta3 S239C microtubule
22AK 2.41 Å, GDP human alpha1A/beta3 microtubule
22AJ 2.48 Å, GDP human alpha1A/beta3 S239C microtubule
9OX7 2.69 Å, In situ microtubule structure in the axon of a human neuron
8SH7 2.8 Å, TUBB4B and TUBA1A Heterodimer from Human Respiratory Doublet Microtubules
6WSL 3.1 Å, Cryo-EM structure of VASH1-SVBP bound to microtubules
7UNG 3.6 Å, 48-nm repeat of the human respiratory doublet microtubule
5JCO 4.0 Å, Structure and dynamics of single-isoform recombinant neuronal human tubulin

Browse structure collections

About this viewer

MolViewer shows 7C1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.