7CK6: Protein translocase of mitochondria

Protein translocase of mitochondria. Determined by electron microscopy at 3.4 Å resolution. Released 4 Nov 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 10
Atoms: 7,460
Mol. weight: 148.33 kDa
Ligands: PC1
Released: 4 Nov 2020

Explore 7CK6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CK6 contains 17 α-helices and 44 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	84-87	4
α-helix	88-91	4
β-strand	100	1	1
β-strand	103-107	5	2
β-strand	113-119	7	2
β-strand	130-136	7	2
β-strand	149-154	6	2
β-strand	161-165	5	2
β-strand	172-180	9	2
β-strand	185-195	11	2
β-strand	199-209	11	2
β-strand	214-224	11	2
β-strand	229-240	12	2
β-strand	243-255	13	2
β-strand	259-266	8	2
β-strand	269-277	9	2
β-strand	283-291	9	2
β-strand	298-307	10	2
β-strand	312-319	8	2
β-strand	323-332	10	2
β-strand	337-346	10	2
β-strand	351-353	3	2
β-strand	355	1	1
β-strand	356-359	4	2

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	67-117	51

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	67-95	29
α-helix	97-117	21

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
α-helix	43-65	23

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
α-helix	44-65	22

Chains G and H: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-36	30
α-helix	49-53	5

Chains I and J: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	13-47	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import receptor subunit TOM40 homolog	A, B	protein	361	Homo sapiens	O96008 (AlphaFold model)
Mitochondrial import receptor subunit TOM22 homolog	C, D	protein	142	Homo sapiens	Q9NS69 (AlphaFold model)
Mitochondrial import receptor subunit TOM6 homolog	E, F	protein	74	Homo sapiens	Q96B49 (AlphaFold model)
Mitochondrial import receptor subunit TOM7 homolog	G, H	protein	55	Homo sapiens	Q9P0U1 (AlphaFold model)
Mitochondrial import receptor subunit TOM5 homolog	I, J	protein	51	Homo sapiens	Q8N4H5

Sequence of entity 1 (A, B), FASTA

>7CK6_1 Mitochondrial import receptor subunit TOM40 homolog (chains A, B)
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G

Sequence of entity 2 (C, D), FASTA

>7CK6_2 Mitochondrial import receptor subunit TOM22 homolog (chains C, D)
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPSLPGKI

Sequence of entity 3 (E, F), FASTA

>7CK6_3 Mitochondrial import receptor subunit TOM6 homolog (chains E, F)
MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV

Sequence of entity 4 (G, H), FASTA

>7CK6_4 Mitochondrial import receptor subunit TOM7 homolog (chains G, H)
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Sequence of entity 5 (I, J), FASTA

>7CK6_5 Mitochondrial import receptor subunit TOM5 homolog (chains I, J)
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

Ligands and cofactors

ID	Name	Formula	Copies
PC1	1,2-diacyl-sn-glycero-3-phosphocholine	C44 H88 N O8 P	1

Primary citation

Atomic structure of human TOM core complex. Wang, W., Chen, X., Zhang, L. et al. Cell Discov (2020) 6:67-67. DOI 10.1038/s41421-020-00198-2 · PubMed

Other PDB entries of the same protein (UniProt O96008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VD2 2.53 Å, Human TOM complex without cross-linking
7VBY 2.54 Å, Tom core complex with Tom20 and Tom22 subunits.
9EII 2.75 Å, Import stalled PINK1 TOM complex, symmetry expanded
9JXV 2.89 Å, human translocase of the outer mitochondrial membrane (TOM complex)
8XDN 2.93 Å, TOM complex with small molecule
9WV3 2.98 Å, Human TOM complex with substrate Tim22-GGC1-sfGFP
7CP9 3.0 Å, Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom.
9EIH 3.1 Å, Import stalled PINK1 TOM complex
9WV2 3.15 Å, Human TOM complex with substrate GGC1-sfGFP
9EIJ 3.3 Å, Import stalled PINK1 TOM complex, extended TOM20 helix class
7VC4 3.74 Å, Tom complex with Tom22 and Tom20 subunits
7VDD 3.74 Å, Human TOM complex with cross-linking

Browse structure collections

About this viewer

MolViewer shows 7CK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.