9WV2: Human TOM complex with substrate GGC1-sfGFP
Human TOM complex with substrate GGC1-sfGFP. Determined by electron microscopy at 3.15 Å resolution. Released 5 Aug 2026.
- Method
- Electron microscopy
- Resolution
- 3.15 Å
- Organisms
- Homo sapiens, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 11
- Atoms
- 8,360
- Mol. weight
- 198.51 kDa
- Ligands
- R16, PC1
- Released
- 5 Aug 2026
Explore 9WV2 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9WV2 contains 24 α-helices and 50 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-45 | 32 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-46 | 33 | |
Chain C: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-36 | 10 | |
| α-helix | 41-60 | 20 | |
Chain D: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-34 | 8 | |
| α-helix | 41-61 | 21 | |
Chain E: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-24 | 19 | |
| α-helix | 28-38 | 11 | |
| α-helix | 45-47 | 3 | |
| α-helix | 49-52 | 4 | |
Chain F: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-24 | 17 | |
| α-helix | 28-37 | 10 | |
| α-helix | 49-52 | 4 | |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 68-95 | 28 | |
| α-helix | 97-115 | 19 | |
Chain H: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 68-95 | 28 | |
| α-helix | 97-114 | 18 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Mitochondrial import receptor subunit TOM5 homolog | A, B | protein | 51 | Homo sapiens | Q8N4H5 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM6 homolog | C, D | protein | 74 | Homo sapiens | Q96B49 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM7 homolog | E, F | protein | 55 | Homo sapiens | Q9P0U1 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM22 homolog | G, H | protein | 142 | Homo sapiens | Q9NS69 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM40 homolog | I, J | protein | 361 | Homo sapiens | O96008 |
| Mitochondrial GTP/GDP carrier protein 1 | K | protein | 300 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P38988 |
Sequence of entity 1 (A, B), FASTA
>9WV2_1 Mitochondrial import receptor subunit TOM5 homolog (chains A, B)
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
Sequence of entity 2 (C, D), FASTA
>9WV2_2 Mitochondrial import receptor subunit TOM6 homolog (chains C, D)
MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV
Sequence of entity 3 (E, F), FASTA
>9WV2_3 Mitochondrial import receptor subunit TOM7 homolog (chains E, F)
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
Sequence of entity 4 (G, H), FASTA
>9WV2_4 Mitochondrial import receptor subunit TOM22 homolog (chains G, H)
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPSLPGKI
Sequence of entity 5 (I, J), FASTA
>9WV2_5 Mitochondrial import receptor subunit TOM40 homolog (chains I, J)
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G
Sequence of entity 6 (K), FASTA
>9WV2_6 Mitochondrial GTP/GDP carrier protein 1 (chains K)
MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF
SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM
RSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAAR
NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGASSSLIVSAPLDVIKTRIQN
RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| R16 | Hexadecane | C16 H34 | 5 |
| PC1 | 1,2-diacyl-sn-glycero-3-phosphocholine | C44 H88 N O8 P | 21 |
Primary citation
Direct coupling of human TOM and TIM22 complexes drives mitochondrial carrier import. Liu, X., Cai, H., Wang, H. et al. Nat Struct Mol Biol (2026) 33:1224-1235. DOI 10.1038/s41594-026-01849-w · PubMed
Other PDB entries of the same protein (UniProt Q8N4H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7VD2 2.53 Å, Human TOM complex without cross-linking
- 7VBY 2.54 Å, Tom core complex with Tom20 and Tom22 subunits.
- 9EII 2.75 Å, Import stalled PINK1 TOM complex, symmetry expanded
- 9JXV 2.89 Å, human translocase of the outer mitochondrial membrane (TOM complex)
- 8XDN 2.93 Å, TOM complex with small molecule
- 9WV3 2.98 Å, Human TOM complex with substrate Tim22-GGC1-sfGFP
- 7CP9 3.0 Å, Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom.
- 9EIH 3.1 Å, Import stalled PINK1 TOM complex
- 9EIJ 3.3 Å, Import stalled PINK1 TOM complex, extended TOM20 helix class
- 7CK6 3.4 Å, Protein translocase of mitochondria
- 7VC4 3.74 Å, Tom complex with Tom22 and Tom20 subunits
- 7VDD 3.74 Å, Human TOM complex with cross-linking
Browse structure collections
About this viewer
MolViewer shows 9WV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.