9WV3: PDB entry 9WV3
Human TOM complex with substrate Tim22-GGC1-sfGFP. Determined by electron microscopy at 2.98 Å resolution. Released 5 Aug 2026.
- Method
- Electron microscopy
- Resolution
- 2.98 Å
- Organisms
- Homo sapiens, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 12
- Atoms
- 8,800
- Mol. weight
- 234.47 kDa
- Ligands
- R16, PC1
- Released
- 5 Aug 2026
Explore 9WV3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9WV3 contains 28 α-helices and 45 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-17 | 4 | |
| α-helix | 21-47 | 27 | |
Chains C and D: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-34 | 9 | |
| α-helix | 41-59 | 19 | |
Chains E and F: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-25 | 20 | |
| α-helix | 28-38 | 11 | |
| α-helix | 45-47 | 3 | |
| α-helix | 49-52 | 4 | |
Chains G and H: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 73-95 | 23 | |
| α-helix | 97-114 | 18 | |
Chain I: 3 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 77-79 | 3 | |
| α-helix | 88-91 | 4 | |
| α-helix | 95-97 | 3 | |
| β-strand | 100-108 | 9 | 1 |
| β-strand | 113-121 | 9 | 1 |
| β-strand | 128-139 | 12 | 1 |
| β-strand | 147-154 | 8 | 1 |
| β-strand | 160-166 | 7 | 1 |
| β-strand | 172-180 | 9 | 1 |
| β-strand | 185-190 | 6 | 1 |
| β-strand | 193-195 | 3 | 1 |
| β-strand | 199-205 | 7 | 1 |
| β-strand | 209 | 1 | 2 |
| β-strand | 214 | 1 | 2 |
| β-strand | 215-226 | 12 | 1 |
| β-strand | 229-240 | 12 | 1 |
| β-strand | 243-255 | 13 | 1 |
| β-strand | 259-264 | 6 | 1 |
| β-strand | 266 | 1 | 1 |
| β-strand | 269-277 | 9 | 1 |
| β-strand | 282-291 | 10 | 1 |
| β-strand | 296-307 | 12 | 1 |
| β-strand | 312-319 | 8 | 1 |
| β-strand | 323-331 | 9 | 1 |
| β-strand | 338-346 | 9 | 1 |
| β-strand | 351-359 | 9 | 1 |
Chain J: 3 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 77-79 | 3 | |
| α-helix | 88-91 | 4 | |
| α-helix | 95-97 | 3 | |
| β-strand | 100-108 | 9 | 3 |
| β-strand | 113-121 | 9 | 3 |
| β-strand | 128-139 | 12 | 3 |
| β-strand | 147-154 | 8 | 3 |
| β-strand | 160-166 | 7 | 3 |
| β-strand | 172-180 | 9 | 3 |
| β-strand | 185-195 | 11 | 3 |
| β-strand | 199-205 | 7 | 3 |
| β-strand | 209 | 1 | 4 |
| β-strand | 214 | 1 | 4 |
| β-strand | 215-226 | 12 | 3 |
| β-strand | 229-240 | 12 | 3 |
| β-strand | 243-255 | 13 | 3 |
| β-strand | 259-264 | 6 | 3 |
| β-strand | 266 | 1 | 3 |
| β-strand | 269-277 | 9 | 3 |
| β-strand | 282-291 | 10 | 3 |
| β-strand | 296-307 | 12 | 3 |
| β-strand | 312-319 | 8 | 3 |
| β-strand | 323-331 | 9 | 3 |
| β-strand | 338-346 | 9 | 3 |
| β-strand | 351-359 | 9 | 3 |
Chains K and L: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 264-273 | 10 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Mitochondrial import receptor subunit TOM5 homolog | A, B | protein | 51 | Homo sapiens | Q8N4H5 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM6 homolog | C, D | protein | 74 | Homo sapiens | Q96B49 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM7 homolog | E, F | protein | 55 | Homo sapiens | Q9P0U1 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM22 homolog | G, H | protein | 142 | Homo sapiens | Q9NS69 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM40 homolog | I, J | protein | 361 | Homo sapiens | O96008 |
| Mitochondrial GTP/GDP carrier protein 1 | K, L | protein | 300 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P38988 |
Sequence of entity 1 (A, B), FASTA
>9WV3_1 Mitochondrial import receptor subunit TOM5 homolog (chains A, B)
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
Sequence of entity 2 (C, D), FASTA
>9WV3_2 Mitochondrial import receptor subunit TOM6 homolog (chains C, D)
MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV
Sequence of entity 3 (E, F), FASTA
>9WV3_3 Mitochondrial import receptor subunit TOM7 homolog (chains E, F)
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
Sequence of entity 4 (G, H), FASTA
>9WV3_4 Mitochondrial import receptor subunit TOM22 homolog (chains G, H)
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPSLPGKI
Sequence of entity 5 (I, J), FASTA
>9WV3_5 Mitochondrial import receptor subunit TOM40 homolog (chains I, J)
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G
Sequence of entity 6 (K, L), FASTA
>9WV3_6 Mitochondrial GTP/GDP carrier protein 1 (chains K, L)
MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF
SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM
RSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAAR
NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGASSSLIVSAPLDVIKTRIQN
RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| R16 | Hexadecane | C16 H34 | 10 |
| PC1 | 1,2-diacyl-sn-glycero-3-phosphocholine | C44 H88 N O8 P | 23 |
Primary citation
Direct coupling of human TOM and TIM22 complexes drives mitochondrial carrier import. Liu, X., Cai, H., Wang, H. et al. Nat Struct Mol Biol (2026) 33:1224-1235. DOI 10.1038/s41594-026-01849-w · PubMed
Other PDB entries of the same protein (UniProt Q8N4H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7VD2 2.53 Å, Human TOM complex without cross-linking
- 7VBY 2.54 Å, Tom core complex with Tom20 and Tom22 subunits.
- 9EII 2.75 Å, Import stalled PINK1 TOM complex, symmetry expanded
- 9JXV 2.89 Å, human translocase of the outer mitochondrial membrane (TOM complex)
- 8XDN 2.93 Å, TOM complex with small molecule
- 7CP9 3.0 Å, Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom.
- 9EIH 3.1 Å, Import stalled PINK1 TOM complex
- 9WV2 3.15 Å, Human TOM complex with substrate GGC1-sfGFP
- 9EIJ 3.3 Å, Import stalled PINK1 TOM complex, extended TOM20 helix class
- 7CK6 3.4 Å, Protein translocase of mitochondria
- 7VC4 3.74 Å, Tom complex with Tom22 and Tom20 subunits
- 7VDD 3.74 Å, Human TOM complex with cross-linking
Browse structure collections
About this viewer
MolViewer shows 9WV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.