7CP9: Human mitochondrial translocase TOM complex
Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom. Determined by electron microscopy at 3.0 Å resolution. Released 28 Apr 2021.
- Method
- Electron microscopy
- Resolution
- 3.0 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 8,530
- Mol. weight
- 156.23 kDa
- Ligands
- PC1
- Released
- 28 Apr 2021
Explore 7CP9 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7CP9 contains 28 α-helices and 46 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-40 | 28 | |
| α-helix | 42-45 | 4 | |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-39 | 28 | |
| α-helix | 42-45 | 4 | |
Chains C and D: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-32 | 13 | |
| α-helix | 42-59 | 18 | |
Chains E and F: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-37 | 33 | |
| β-strand | 42 | 1 | 1 |
| β-strand | 44 | 1 | 1 |
| α-helix | 45-46 | 2 | |
| α-helix | 49-52 | 4 | |
Chains G and H: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-38 | 9 | |
| α-helix | 45-54 | 10 | |
| α-helix | 59-95 | 37 | |
| α-helix | 97-116 | 20 | |
Chains I and J: 3 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 77-79 | 3 | |
| α-helix | 85-91 | 7 | |
| α-helix | 95-98 | 4 | |
| β-strand | 100-107 | 8 | 3 |
| β-strand | 114-121 | 8 | 3 |
| β-strand | 128-136 | 9 | 3 |
| β-strand | 142 | 1 | 4 |
| β-strand | 145 | 1 | 4 |
| β-strand | 149-154 | 6 | 3 |
| β-strand | 160-166 | 7 | 3 |
| β-strand | 172-181 | 10 | 3 |
| β-strand | 184-196 | 13 | 3 |
| β-strand | 199-206 | 8 | 3 |
| β-strand | 215-224 | 10 | 3 |
| β-strand | 229-240 | 12 | 3 |
| β-strand | 243-255 | 13 | 3 |
| β-strand | 259-264 | 6 | 3 |
| β-strand | 270-279 | 10 | 3 |
| β-strand | 282-291 | 10 | 3 |
| β-strand | 296-307 | 12 | 3 |
| β-strand | 312-319 | 8 | 3 |
| β-strand | 323-332 | 10 | 3 |
| β-strand | 337-346 | 10 | 3 |
| β-strand | 351-359 | 9 | 3 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Mitochondrial import receptor subunit TOM5 homolog | A, B | protein | 51 | Homo sapiens | Q8N4H5 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM6 homolog | C, D | protein | 74 | Homo sapiens | Q96B49 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM7 homolog | E, F | protein | 55 | Homo sapiens | Q9P0U1 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM22 homolog | G, H | protein | 142 | Homo sapiens | Q9NS69 (AlphaFold model) |
| Mitochondrial import receptor subunit TOM40 homolog | I, J | protein | 361 | Homo sapiens | O96008 |
Sequence of entity 1 (A, B), FASTA
>7CP9_1 Mitochondrial import receptor subunit TOM5 homolog (chains A, B)
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
Sequence of entity 2 (C, D), FASTA
>7CP9_2 Mitochondrial import receptor subunit TOM6 homolog (chains C, D)
MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV
Sequence of entity 3 (E, F), FASTA
>7CP9_3 Mitochondrial import receptor subunit TOM7 homolog (chains E, F)
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
Sequence of entity 4 (G, H), FASTA
>7CP9_4 Mitochondrial import receptor subunit TOM22 homolog (chains G, H)
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPSLPGKI
Sequence of entity 5 (I, J), FASTA
>7CP9_5 Mitochondrial import receptor subunit TOM40 homolog (chains I, J)
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PC1 | 1,2-diacyl-sn-glycero-3-phosphocholine | C44 H88 N O8 P | 11 |
Primary citation
Structural insights into assembly of human mitochondrial translocase TOM complex. Guan, Z., Yan, L., Wang, Q. et al. Cell Discov (2021) 7:22-22. DOI 10.1038/s41421-021-00252-7 · PubMed
Other PDB entries of the same protein (UniProt Q8N4H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7VD2 2.53 Å, Human TOM complex without cross-linking
- 7VBY 2.54 Å, Tom core complex with Tom20 and Tom22 subunits.
- 9EII 2.75 Å, Import stalled PINK1 TOM complex, symmetry expanded
- 9JXV 2.89 Å, human translocase of the outer mitochondrial membrane (TOM complex)
- 8XDN 2.93 Å, TOM complex with small molecule
- 9WV3 2.98 Å, Human TOM complex with substrate Tim22-GGC1-sfGFP
- 9EIH 3.1 Å, Import stalled PINK1 TOM complex
- 9WV2 3.15 Å, Human TOM complex with substrate GGC1-sfGFP
- 9EIJ 3.3 Å, Import stalled PINK1 TOM complex, extended TOM20 helix class
- 7CK6 3.4 Å, Protein translocase of mitochondria
- 7VC4 3.74 Å, Tom complex with Tom22 and Tom20 subunits
- 7VDD 3.74 Å, Human TOM complex with cross-linking
Browse structure collections
About this viewer
MolViewer shows 7CP9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.