7CQF: PSD-95 PDZ3 fused with ADAM22 C-terminal peptide

Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 6 Jan 2021.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 1
Atoms: 953
Mol. weight: 16.83 kDa
Ligands: CHT
Released: 6 Jan 2021

Explore 7CQF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CQF contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	1
β-strand	325-329	5	1
β-strand	336-341	6	1
α-helix	346-350	5
β-strand	357-362	6	1
β-strand	365-366	2	1
α-helix	372-380	9
β-strand	385-392	8	1
α-helix	394-410	17
β-strand	439-440	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4,Disintegrin and metalloproteinase domain-containing protein 22	A	protein	150	Rattus norvegicus, Homo sapiens	P31016 (AlphaFold model), Q9P0K1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CQF_1 Disks large homolog 4,Disintegrin and metalloproteinase domain-containing protein 22 (chains A)
MNHKVHHHHHHIEGRHNREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG
ELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQL
MNSSLGSGTASGSSGKKVNRQSARLWETSI

Ligands and cofactors

ID	Name	Formula	Copies
CHT	Choline ion	C5 H14 N O	1

Water and common crystallization additives (CL, EDO) are not listed.

Primary citation

LGI1-ADAM22-MAGUK configures transsynaptic nanoalignment for synaptic transmission and epilepsy prevention. Fukata, Y., Chen, X., Chiken, S. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2022580118 · PubMed

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…

Browse structure collections

About this viewer

MolViewer shows 7CQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.