7CQH: Complex of TRP_CBS2 and Calmodulin_Clobe

Complex of TRP_CBS2 and Calmodulin_Clobe. Determined by X-ray diffraction at 2.15 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 692
Mol. weight: 13.31 kDa
Ligands: CA
Released: 23 Jun 2021

Explore 7CQH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CQH contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-13	9
α-helix	15-23	9

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	20-21	2	1
α-helix	23-31	9
α-helix	39-47	9
β-strand	57-58	2	1
α-helix	59-66	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT15141p	B	protein	73	Drosophila melanogaster	P62152 (AlphaFold model)
Transient receptor potential protein	A	protein	44	Drosophila melanogaster	P19334 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7CQH_1 AT15141p (chains B)
GPDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ
VNYEEFVTMMTSK

Sequence of entity 2 (A), FASTA

>7CQH_2 Transient receptor potential protein (chains A)
GPMNQTQLIEFNPNLGDVTRATRVAYVKFMRKKMAADEVSLADD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Calmodulin binds to Drosophila TRP with an unexpected mode. Chen, W., Shen, Z., Asteriti, S. et al. Structure (2021) 29:330-344.e4. DOI 10.1016/j.str.2020.11.016 · PubMed

Other PDB entries of the same protein (UniProt P62152 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MXE 1.7 Å, Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4CLN 2.2 Å, Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-Å…
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
8ZLW 2.2 Å, Crystal Structure of RDGC IQ motif/dCaM Complex
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4PJJ 2.4 Å, MYOSIN VI (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state - long soaking with PO4
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm

Browse structure collections

About this viewer

MolViewer shows 7CQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.