7CUH: Fission yeast Pot1 and ssDNA

Crystal structure of fission yeast Pot1 and ssDNA. Determined by X-ray diffraction at 3.0 Å resolution. Released 25 Aug 2021.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Schizosaccharomyces pombe (strain 972 / ATCC 24843), Schizosaccharomyces pombe
Chains: 2
Atoms: 2,899
Mol. weight: 45.14 kDa
Released: 25 Aug 2021

Explore 7CUH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CUH contains 8 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	9-15	7
β-strand	19-22	4	1
β-strand	25-28	4	1
α-helix	30-33	4
β-strand	41-52	12	1
β-strand	56-57	2	1
β-strand	65-72	8	1
β-strand	83-89	7	1
β-strand	104-115	12	1
β-strand	118-131	14	1
α-helix	148-150	3
α-helix	156-172	17
β-strand	201	1	2
α-helix	204-206	3
β-strand	212-225	14	3
β-strand	228-234	7	3
β-strand	245	1	4
β-strand	259	1	4
β-strand	263-267	5	3
α-helix	270-275	6
β-strand	284-294	11	3
β-strand	300-304	5	3
β-strand	315-318	4	3
α-helix	324-326	3
α-helix	327-334	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein 1	A	protein	339	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O13988 (AlphaFold model)
Telomere single-strand DNA	B	DNA	18	Schizosaccharomyces pombe

Sequence of entity 1 (A), FASTA

>7CUH_1 Protection of telomeres protein 1 (chains A)
MGEDVIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLH
GTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQ
GLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNKHKNGE
LLSTSSARQNQTGLSYPSVSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENE
LFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYL
ECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYVQN

Sequence of entity 2 (B), FASTA

>7CUH_2 Telomere single-strand DNA (chains B)
GGTTACAGGGGTTACGGT

Primary citation

Structural insights into Pot1-ssDNA, Pot1-Tpz1 and Tpz1-Ccq1 Interactions within fission yeast shelterin complex. Sun, H., Wu, Z., Zhou, Y. et al. PLoS Genet (2022) 18:e1010308-e1010308. DOI 10.1371/journal.pgen.1010308 · PubMed

Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5USB 1.61 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HIK 1.64 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGGT)
4HIM 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGATACGGT)
4HIO 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTAACGGT)
4HJ7 1.78 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTAGGGT)
4HID 1.82 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GCTTACGGT)
4HJ9 1.85 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (CGGTTACGGT)
1QZG 1.9 Å, Crystal structure of Pot1 (protection of telomere)- ssDNA complex
5USN 1.9 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
5USO 2.0 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HJ5 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTTCGGT)
4HJ8 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGCT)

Browse structure collections

About this viewer

MolViewer shows 7CUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.