7CUI: Fission yeast Pot1 and Tpz1

Crystal structure of fission yeast Pot1 and Tpz1. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 Aug 2021.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 4
Atoms: 3,397
Mol. weight: 64.05 kDa
Released: 25 Aug 2021

Explore 7CUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CUI contains 29 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	373	1
β-strand	374	1	1
α-helix	375	1
β-strand	378-380	3	2
β-strand	387	1	1
α-helix	390-394	5
β-strand	405-417	13	1
α-helix	421-423	3
β-strand	425-429	5	3
β-strand	433-436	4	3
β-strand	437-443	7	1
β-strand	449-455	7	1
α-helix	456-463	8
α-helix	477-491	15
α-helix	494-504	11
α-helix	508-510	3
α-helix	511-514	4
α-helix	516-518	3
β-strand	519-527	9	1
α-helix	542-544	3
β-strand	546-550	5	1
β-strand	552-554	3	2

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	188-190	3
α-helix	196-198	3
α-helix	199-201	3
α-helix	202-211	10

Chain C: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	373	1
β-strand	374	1	4
α-helix	375	1
β-strand	378-380	3	5
β-strand	387	1	4
α-helix	390-394	5
β-strand	406-417	12	4
α-helix	421-423	3
β-strand	425-429	5	6
β-strand	433-436	4	6
β-strand	437-443	7	4
β-strand	449-455	7	4
α-helix	456-463	8
α-helix	473-475	3
α-helix	477-491	15
α-helix	494-504	11
α-helix	508-514	7
α-helix	517-518	2
β-strand	519-527	9	4
α-helix	542-544	3
β-strand	546-550	5	4
β-strand	552-554	3	5

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	188-190	3
α-helix	195-198	4
α-helix	202-210	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein 1	A, C	protein	199	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O13988 (AlphaFold model)
Protection of telomeres protein tpz1	B, D	protein	77	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O14246 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7CUI_1 Protection of telomeres protein 1 (chains A, C)
SENPFIAHELKQTSVNEITAHVINEPASLKLTTISTILHAPLQNLLKPRKHRLRVQVVDF
WPKSLTQFAVLSQPPSSYVWMFALLVRDVSNVTLPVIFFDSDAAELINSSKIQPCNLADH
PQMTLQLKERLFLIWGNLEERIQHHISKGESPTLAAEDVETPWFDIYVKEYIPVIGNTKD
HQSLTFLQKRWRGFGTKIV

Sequence of entity 2 (B, D), FASTA

>7CUI_2 Protection of telomeres protein tpz1 (chains B, D)
SQQEKPNDNTSNSRDIKNNIQFHWKNMTSLSIEECIIPKGQQLILEKESEENTTHGIYLE
ERKMAQGLHNSVSETPE

Primary citation

Structural insights into Pot1-ssDNA, Pot1-Tpz1 and Tpz1-Ccq1 Interactions within fission yeast shelterin complex. Sun, H., Wu, Z., Zhou, Y. et al. PLoS Genet (2022) 18:e1010308-e1010308. DOI 10.1371/journal.pgen.1010308 · PubMed

Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5USB 1.61 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HIK 1.64 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGGT)
4HIM 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGATACGGT)
4HIO 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTAACGGT)
4HJ7 1.78 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTAGGGT)
4HID 1.82 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GCTTACGGT)
4HJ9 1.85 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (CGGTTACGGT)
1QZG 1.9 Å, Crystal structure of Pot1 (protection of telomere)- ssDNA complex
5USN 1.9 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
5USO 2.0 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HJ5 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTTCGGT)
4HJ8 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGCT)

Browse structure collections

About this viewer

MolViewer shows 7CUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.