7EYF: Nuclear pore complex protein Nup155

Cryo-EM (SPA) structure of human Nup155 C-terminus (864-1337) at 5.3 Angstroms resolution. Determined by electron microscopy at 5.3 Å resolution. Released 8 Jun 2022.

Method: Electron microscopy
Resolution: 5.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,834
Mol. weight: 60.59 kDa
Released: 8 Jun 2022

Explore 7EYF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EYF contains 31 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	874-885	12
α-helix	894-899	6
α-helix	900-904	5
α-helix	915-922	8
α-helix	927-940	14
α-helix	945-952	8
α-helix	968-983	16
α-helix	997-998	2
α-helix	1002-1003	2
α-helix	1015-1028	14
α-helix	1038-1040	3
α-helix	1051-1054	4
α-helix	1060-1069	10
α-helix	1071-1083	13
α-helix	1102-1104	3
α-helix	1113-1121	9
α-helix	1134-1138	5
α-helix	1139-1162	24
α-helix	1171-1178	8
α-helix	1186-1187	2
α-helix	1188-1192	5
α-helix	1200-1208	9
α-helix	1214-1234	21
α-helix	1240-1254	15
α-helix	1256-1258	3
α-helix	1264-1277	14
α-helix	1282-1291	10
α-helix	1296-1305	10
α-helix	1312-1314	3
α-helix	1319-1321	3
α-helix	1323-1333	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup155	A	protein	528	Homo sapiens	O75694 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7EYF_1 Nuclear pore complex protein Nup155 (chains A)
PLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQV
RFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELV
NQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWL
IQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLAD
MHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQR
QYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQD
IIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVG
FVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLN
CERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH

Primary citation

Cryo-EM (SPA) structure of human Nup155 C-terminus (864-1337) at 5.3 Angstroms resolution. Niranjan, S. To be published.

Other PDB entries of the same protein (UniProt O75694 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7R1Y 3.0 Å, cryoEM structure of human Nup155 (residues 19-981)
7EYE 5.1 Å, Cryo-EM (SPA) structure of Nup155 N-terminus (19-863) at 5.1 Angstrom resolution
7EYQ 5.4 Å, Cryo-EM (SPA) structure of human Nup155 Longer N-terminus (19-1069) at 5.4 Angstrom…
7R5K 12.0 Å, Human nuclear pore complex (constricted)
5IJN 21.4 Å, Composite structure of the inner ring of the human nuclear pore complex (32 copies of…
5IJO 21.4 Å, Alternative composite structure of the inner ring of the human nuclear pore complex (16…
5A9Q 23.0 Å, Human nuclear pore complex
7PER 35.0 Å, Model of the inner ring of the human nuclear pore complex
7R5J 50.0 Å, Human nuclear pore complex (dilated)
9A25 Molecular assembly pathway of the human Nuclear Pore Complex after cell division
9A8T Integrative spatiotemporal modeling of biomolecular processes: application to the…

Browse structure collections

About this viewer

MolViewer shows 7EYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.