7R1Y: Human Nup155

cryoEM structure of human Nup155 (residues 19-981). Determined by electron microscopy at 3.0 Å resolution. Released 8 Jun 2022.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,704
Mol. weight: 155 kDa
Released: 8 Jun 2022

Explore 7R1Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7R1Y contains 31 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	20-36	17
α-helix	43-46	4
β-strand	56-58	3	1
β-strand	85-88	4	2
α-helix	89-90	2
α-helix	91-98	8
β-strand	106-107	2	3
β-strand	115-117	3	3
β-strand	124-127	4	3
β-strand	132-135	4	3
β-strand	146-150	5	4
α-helix	151-153	3
β-strand	164-168	5	4
β-strand	172-177	6	4
β-strand	207-209	3	4
β-strand	215-220	6	5
β-strand	226-230	5	5
β-strand	235-239	5	5
β-strand	252-255	4	5
β-strand	265-271	7	6
β-strand	276-281	6	6
β-strand	286-290	5	6
β-strand	299-304	6	6
α-helix	306-317	12
α-helix	322-325	4
β-strand	328-333	6	1
β-strand	344-348	5	1
β-strand	352-357	6	1
α-helix	366-368	3
β-strand	372-377	6	1
α-helix	380-382	3
α-helix	389-391	3
β-strand	394-400	7	7
β-strand	403-408	6	7
β-strand	414-421	8	7
β-strand	434-441	8	7
β-strand	446-449	4	2
α-helix	482-484	3
β-strand	485-489	5	2
β-strand	493-498	6	2
α-helix	499-501	3
α-helix	502-512	11
α-helix	520-527	8
α-helix	530-541	12
α-helix	549-561	13
α-helix	647-660	14
α-helix	661-663	3
β-strand	667	1	8
β-strand	670-671	2	9
β-strand	684-685	2	9
α-helix	690-709	20
α-helix	761-786	26
α-helix	789-794	6
α-helix	798-805	8
β-strand	808	1	8
α-helix	809-810	2
α-helix	811-815	5
α-helix	819-833	15
α-helix	839-848	10
α-helix	855-869	15
α-helix	876-891	16
α-helix	899-908	10
α-helix	912-926	15
α-helix	951-966	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup155	A	protein	1388	Homo sapiens	O75694 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7R1Y_1 Nuclear pore complex protein Nup155 (chains A)
GPPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSG
MSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTI
DSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLS
YANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVA
YQAEAGWFSQRCRKINHSKSSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMS
RVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTC
PFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWC
VNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQH
MLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLI
LACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSP
YPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRI
MGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLG
NPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALA
LWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVD
GISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDL
SNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYK
CITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDE
LFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSN
AARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARI
QLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSD
PILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQ
QVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIR
YVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLHSA
WSHPQFEK

Primary citation

AI-based structure prediction empowers integrative structural analysis of human nuclear pores. Mosalaganti, S., Obarska-Kosinska, A., Siggel, M. et al. Science (2022) 376:eabm9506-eabm9506. DOI 10.1126/science.abm9506 · PubMed

Other PDB entries of the same protein (UniProt O75694 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EYE 5.1 Å, Cryo-EM (SPA) structure of Nup155 N-terminus (19-863) at 5.1 Angstrom resolution
7EYF 5.3 Å, Cryo-EM (SPA) structure of human Nup155 C-terminus (864-1337) at 5.3 Angstroms resolution
7EYQ 5.4 Å, Cryo-EM (SPA) structure of human Nup155 Longer N-terminus (19-1069) at 5.4 Angstrom…
7R5K 12.0 Å, Human nuclear pore complex (constricted)
5IJN 21.4 Å, Composite structure of the inner ring of the human nuclear pore complex (32 copies of…
5IJO 21.4 Å, Alternative composite structure of the inner ring of the human nuclear pore complex (16…
5A9Q 23.0 Å, Human nuclear pore complex
7PER 35.0 Å, Model of the inner ring of the human nuclear pore complex
7R5J 50.0 Å, Human nuclear pore complex (dilated)
9A25 Molecular assembly pathway of the human Nuclear Pore Complex after cell division
9A8T Integrative spatiotemporal modeling of biomolecular processes: application to the…

Browse structure collections

About this viewer

MolViewer shows 7R1Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.