7EZJ: P73 DNA binding domain complex

Crystal structure of p73 DNA binding domain complex bound with 1 bp and 2 bp spacer DNA response elements. Determined by X-ray diffraction at 2.9 Å resolution. Released 13 Apr 2022.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 32
Atoms: 29,062
Mol. weight: 440.08 kDa
Ligands: ZN
Released: 13 Apr 2022

Explore 7EZJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EZJ contains 83 α-helices and 195 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	19
β-strand	128-130	3	20
β-strand	142-145	4	19
β-strand	150-153	4	19
β-strand	159-164	6	20
α-helix	168-170	3
β-strand	174-181	8	19
α-helix	190-191	2
α-helix	195-198	4
β-strand	215-218	4	20
β-strand	224-227	4	19
β-strand	234-239	6	19
β-strand	250-256	7	20
β-strand	271-278	8	19
β-strand	284-294	11	19
α-helix	298-308	11

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	1
β-strand	128-130	3	2
β-strand	142-145	4	1
β-strand	150-154	5	1
β-strand	159-164	6	2
α-helix	168-170	3
β-strand	174-181	8	1
α-helix	184-186	3
α-helix	190-191	2
α-helix	195-198	4
β-strand	215-218	4	2
β-strand	224-227	4	1
β-strand	234-239	6	1
α-helix	243-244	2
β-strand	250-256	7	2
β-strand	271-278	8	1
β-strand	284-295	12	1
α-helix	298-309	12

Chain b: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	21
β-strand	128-130	3	22
β-strand	142-145	4	21
β-strand	150-153	4	21
β-strand	159-164	6	22
α-helix	168-170	3
β-strand	174-181	8	21
α-helix	195-199	5
β-strand	215-218	4	22
β-strand	224-227	4	21
β-strand	234-239	6	21
α-helix	242-244	3
β-strand	250-256	7	22
β-strand	271-278	8	21
β-strand	284-294	11	21
α-helix	298-307	10

Chain B: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	3
β-strand	128-130	3	4
β-strand	142-145	4	3
β-strand	150-153	4	3
β-strand	159-164	6	4
α-helix	168-170	3
β-strand	174-181	8	3
α-helix	184-186	3
α-helix	195-199	5
β-strand	215-217	3	4
β-strand	224-227	4	3
β-strand	234-239	6	3
α-helix	242-244	3
β-strand	250-256	7	4
β-strand	271-278	8	3
β-strand	284-294	11	3
α-helix	298-311	14

Chain c: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	23
β-strand	128-130	3	24
β-strand	142-145	4	23
β-strand	150-153	4	23
β-strand	159-164	6	24
α-helix	168-170	3
β-strand	174-181	8	23
α-helix	184-186	3
α-helix	195-199	5
β-strand	215-218	4	24
β-strand	224-227	4	23
β-strand	234-239	6	23
α-helix	242-244	3
β-strand	250-256	7	24
β-strand	271-278	8	23
β-strand	284-294	11	23
α-helix	298-309	12

Chain C: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	5
β-strand	128-130	3	6
β-strand	142-145	4	5
β-strand	150-153	4	5
β-strand	159-164	6	6
α-helix	168-170	3
β-strand	174-181	8	5
α-helix	190-191	2
α-helix	195-199	5
β-strand	215-217	3	6
β-strand	224-227	4	5
β-strand	234-239	6	5
α-helix	242-244	3
β-strand	250-256	7	6
β-strand	271-278	8	5
β-strand	284-294	11	5
α-helix	298-308	11

Chain d: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	25
β-strand	128-130	3	26
β-strand	142-145	4	25
β-strand	150-153	4	25
β-strand	159-164	6	26
α-helix	168-170	3
β-strand	174-181	8	25
α-helix	195-199	5
β-strand	215-217	3	26
β-strand	224-227	4	25
β-strand	234-239	6	25
α-helix	242-244	3
β-strand	250-256	7	26
β-strand	271-278	8	25
β-strand	284-294	11	25
α-helix	298-307	10

Chain D: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	7
α-helix	123-125	3
β-strand	128-130	3	8
β-strand	142-145	4	7
β-strand	150-153	4	7
β-strand	159-164	6	8
α-helix	168-170	3
β-strand	174-181	8	7
α-helix	184-186	3
α-helix	190-191	2
β-strand	192	1	9
α-helix	195-199	5
β-strand	213	1	9
β-strand	215-218	4	8
β-strand	224-227	4	7
β-strand	234-239	6	7
α-helix	242-244	3
β-strand	250-256	7	8
β-strand	271-278	8	7
β-strand	284-294	11	7
α-helix	298-307	10
α-helix	308-310	3

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p73	A, B, C, D, I, J, K, L, a, b, c, d, i, j, k, l	protein	210	Homo sapiens	O15350 (AlphaFold model)
12-mer DNA	E, F, G, H, M, N, O, P, e, f, g, h, m, n, o, p	DNA	12	Homo sapiens

Sequence of entity 1 (A, B, C, D, I, J, K, L, a, b, c, d, i, j, k, l), FASTA

>7EZJ_1 Tumor protein p73 (chains A, B, C, D, I, J, K, L, a, b, c, d, i, j, k, l)
MGHHHHHHHHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQ
IKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNL
SQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDG
QVLGRRSFEGRICACPGRDRKADEDHYREQ

Sequence of entity 2 (E, F, G, H, M, N, O, P, e, f, g, h, m, n, o, p), FASTA

>7EZJ_2 12-mer DNA (chains E, F, G, H, M, N, O, P, e, f, g, h, m, n, o, p)
CAGGCATGCCTG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	16

Primary citation

Deciphering the mechanism of p73 recognition of p53 response elements using the crystal structure of p73-DNA complexes and computational studies. Koley, T., Roy Chowdhury, S., Kushwaha, T. et al. Int J Biol Macromol (2022) 206:40-50. DOI 10.1016/j.ijbiomac.2022.02.108 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…

Browse structure collections

About this viewer

MolViewer shows 7EZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.