NMR solution structure of Nav1.5 DIV S3b-S4a paddle motif in DPC micelle. Determined by solution NMR. Released 2 Jun 2021.
Explore 7L83 in 3D Show helices and sheets RCSB PDB PDBe
7L83 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-18 | 17 | |
| α-helix | 23-32 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sodium channel protein type 5 subunit alpha | A | protein | 37 | Homo sapiens | Q14524 (AlphaFold model) |
>7L83_1 Sodium channel protein type 5 subunit alpha (chains A) VVVILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRI
NMR solution structure and analysis of isolated S3b-S4a motif of repeat IV of the human cardiac sodium channel. Hussein, A.K., Bhuiyan, M.H., Arshava, B. et al. bioRxiv (2021). DOI 10.1101/2021.05.21.443843
Other PDB entries of the same protein (UniProt Q14524 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7L83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.