Crystal structure of Ras suppressor-1. Determined by X-ray diffraction at 1.76 Å resolution. Released 28 Apr 2021.
Explore 7LT8 in 3D Show helices and sheets RCSB PDB PDBe
7LT8 contains 14 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-14 | 10 | |
| β-strand | 19-21 | 3 | 1 |
| α-helix | 30-32 | 3 | |
| α-helix | 36-38 | 3 | |
| β-strand | 44-46 | 3 | 1 |
| α-helix | 57-61 | 5 | |
| β-strand | 67-69 | 3 | 1 |
| α-helix | 80-84 | 5 | |
| β-strand | 90-92 | 3 | 1 |
| α-helix | 105-107 | 3 | |
| β-strand | 113-115 | 3 | 1 |
| α-helix | 123-125 | 3 | |
| α-helix | 130-132 | 3 | |
| β-strand | 138-140 | 3 | 1 |
| α-helix | 151-155 | 5 | |
| β-strand | 161-163 | 3 | 1 |
| α-helix | 174-178 | 5 | |
| β-strand | 184-186 | 3 | 1 |
| α-helix | 197-201 | 5 | |
| β-strand | 210-212 | 3 | 1 |
| α-helix | 220-228 | 9 | |
| α-helix | 230-238 | 9 | |
| α-helix | 240-250 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ras suppressor protein 1 | A | protein | 280 | Homo sapiens | Q15404 (AlphaFold model) |
>7LT8_1 Ras suppressor protein 1 (chains A) GSHMSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPP NIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLT YNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIG ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYI RSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly. Fukuda, K., Lu, F., Qin, J. J Biol Chem (2021) 296:100685-100685. DOI 10.1016/j.jbc.2021.100685 · PubMed
Other PDB entries of the same protein (UniProt Q15404 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7LT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.