7D2T: Rsu1/PINCH1_LIM45C complex

Crystal structure of Rsu1/PINCH1_LIM45C complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Feb 2021.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,487
Mol. weight: 97.99 kDa
Ligands: ZN
Released: 24 Feb 2021

Explore 7D2T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D2T contains 37 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8
β-strand	19-21	3	1
α-helix	30-32	3
α-helix	36-38	3
β-strand	44-46	3	1
α-helix	57-61	5
β-strand	67-69	3	1
α-helix	80-84	5
β-strand	90-92	3	1
α-helix	105-107	3
β-strand	113-115	3	1
α-helix	123-125	3
α-helix	130-132	3
β-strand	138-140	3	1
α-helix	151-155	5
β-strand	161-163	3	1
α-helix	174-178	5
β-strand	184-186	3	1
α-helix	197-201	5
β-strand	206	1	2
β-strand	210-212	3	1
α-helix	220-228	9
α-helix	230-237	8
α-helix	240-250	11

Chain B: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	192	1	3
β-strand	193	1	4
β-strand	199	1	3
β-strand	204	1	5
β-strand	205-207	3	4
β-strand	210-212	3	4
β-strand	218	1	6
β-strand	225	1	6
β-strand	232-234	3	7
β-strand	237-239	3	7
α-helix	241-248	8
β-strand	251	1	8
β-strand	258	1	8
β-strand	263-266	4	9
β-strand	269-272	4	9
β-strand	277	1	10
β-strand	284	1	10
β-strand	291-294	4	11
β-strand	297-300	4	11
α-helix	301-305	5
α-helix	309-317	9

Chain C: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
β-strand	19-21	3	12
α-helix	30-32	3
α-helix	36-38	3
β-strand	44-46	3	12
β-strand	54	1	13
α-helix	57-61	5
β-strand	67-69	3	12
β-strand	77	1	13
α-helix	80-84	5
β-strand	90-92	3	12
α-helix	105-107	3
β-strand	113-115	3	12
α-helix	123-125	3
α-helix	130-132	3
β-strand	138-140	3	12
α-helix	151-155	5
β-strand	161-163	3	12
α-helix	174-178	5
β-strand	184-186	3	12
α-helix	197-201	5
β-strand	206	1	5
β-strand	210-212	3	12
α-helix	220-228	9
α-helix	230-237	8
α-helix	240-250	11

Chain D: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	192	1	14
β-strand	193	1	15
β-strand	199	1	14
β-strand	204	1	2
β-strand	205-207	3	15
β-strand	210-212	3	15
α-helix	214-216	3
β-strand	218	1	16
β-strand	225	1	16
β-strand	232-234	3	7
β-strand	237-239	3	7
α-helix	241-248	8
α-helix	250	1
β-strand	251	1	17
α-helix	252	1
β-strand	258	1	17
β-strand	263-266	4	18
β-strand	269-272	4	18
β-strand	277	1	19
β-strand	284	1	19
β-strand	291-294	4	20
β-strand	297-300	4	20
α-helix	301-305	5
α-helix	309-316	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras suppressor protein 1	A, C	protein	282	Homo sapiens	Q15404 (AlphaFold model)
LIM and senescent cell antigen-like-containing domain protein 1	B, D	protein	142	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7D2T_1 Ras suppressor protein 1 (chains A, C)
GAMGSMSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMV
PPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLD
LTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKE
IGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFE
YIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR

Sequence of entity 2 (B, D), FASTA

>7D2T_2 LIM and senescent cell antigen-like-containing domain protein 1 (chains B, D)
GPGSMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETH
YNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKC
YEKFPLELKKRLKKLAETLGRK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Water and common crystallization additives (TRS, GOL, PGE) are not listed.

Primary citation

Complex structures of Rsu1 and PINCH1 reveal a regulatory mechanism of the ILK/PINCH/Parvin complex for F-actin dynamics. Yang, H., Lin, L., Sun, K. et al. Elife (2021) 10. DOI 10.7554/eLife.64395 · PubMed

Other PDB entries of the same protein (UniProt Q15404 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D2S 1.65 Å, Crystal structure of Rsu1/PINCH1_LIM5C complex
7LT8 1.76 Å, Crystal structure of Ras suppressor-1
7LT9 3.05 Å, Crystal structure of Ras suppressor-1 in complex with PINCH-1 LIM4-5 domains
7D2U 3.15 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex

Browse structure collections

About this viewer

MolViewer shows 7D2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.