7LT9: Ras suppressor-1

Crystal structure of Ras suppressor-1 in complex with PINCH-1 LIM4-5 domains. Determined by X-ray diffraction at 3.05 Å resolution. Released 28 Apr 2021.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,070
Mol. weight: 48.31 kDa
Ligands: ZN
Released: 28 Apr 2021

Explore 7LT9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LT9 contains 18 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
β-strand	19-21	3	1
α-helix	36-38	3
β-strand	44-46	3	1
α-helix	57-61	5
β-strand	67-69	3	1
α-helix	80-84	5
β-strand	90-92	3	1
α-helix	105-107	3
β-strand	113-115	3	1
α-helix	123-125	3
α-helix	128-132	5
β-strand	138-140	3	1
β-strand	148	1	2
α-helix	151-155	5
β-strand	161-163	3	1
β-strand	171	1	2
α-helix	174-178	5
β-strand	184-186	3	1
α-helix	197-201	5
β-strand	210-212	3	1
α-helix	220-228	9
α-helix	231-238	8
α-helix	240-250	11

Chain B: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	192	1	3
β-strand	199	1	3
α-helix	200	1
β-strand	207	1	4
β-strand	210	1	4
β-strand	218	1	5
β-strand	225	1	5
β-strand	232-234	3	6
β-strand	237-239	3	6
α-helix	241-248	8
β-strand	251	1	7
β-strand	258	1	7
α-helix	259	1
β-strand	263-266	4	8
β-strand	269-272	4	8
β-strand	277	1	9
β-strand	284	1	9
β-strand	291-294	4	10
β-strand	297-300	4	10
α-helix	301-305	5
α-helix	309-315	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras suppressor protein 1	A	protein	280	Homo sapiens	Q15404 (AlphaFold model)
LIM and senescent cell antigen-like-containing domain protein 1	B	protein	141	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7LT9_1 Ras suppressor protein 1 (chains A)
GSHMSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPP
NIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLT
YNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIG
ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYI
RSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR

Sequence of entity 2 (B), FASTA

>7LT9_2 LIM and senescent cell antigen-like-containing domain protein 1 (chains B)
GSPEGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHY
NQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCY
EKFPLELKKRLKKLAETLGRK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly. Fukuda, K., Lu, F., Qin, J. J Biol Chem (2021) 296:100685-100685. DOI 10.1016/j.jbc.2021.100685 · PubMed

Other PDB entries of the same protein (UniProt Q15404 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D2S 1.65 Å, Crystal structure of Rsu1/PINCH1_LIM5C complex
7LT8 1.76 Å, Crystal structure of Ras suppressor-1
7D2T 2.2 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex
7D2U 3.15 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex

Browse structure collections

About this viewer

MolViewer shows 7LT9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.