7M6M: Glycine receptor subunit alphaZ1

Full length alpha1 Glycine receptor in presence of 32uM Tetrahydrocannabinol. Determined by electron microscopy at 3.09 Å resolution. Released 3 Aug 2022.

Method: Electron microscopy
Resolution: 3.09 Å
Organism: Danio rerio
Chains: 5
Atoms: 14,190
Mol. weight: 257.8 kDa
Ligands: TCI
Released: 3 Aug 2022

Explore 7M6M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M6M contains 45 α-helices and 75 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	34-42	9
α-helix	60	1
β-strand	61-76	16	1
β-strand	81-93	13	1
β-strand	106-109	4	1
β-strand	122-124	3	2
β-strand	127-132	6	1
β-strand	134	1	3
β-strand	138	1	3
β-strand	140-145	6	1
β-strand	149-161	13	1
β-strand	173-186	14	2
β-strand	190-194	5	1
β-strand	200-202	3	1
β-strand	211-213	3	2
β-strand	219-225	7	2
β-strand	230-242	13	2
α-helix	245-247	3
α-helix	248-252	5
α-helix	253-262	10
α-helix	264-267	4
α-helix	273-297	25
α-helix	306-327	22
α-helix	402-440	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycine receptor subunit alphaZ1	A, B, C, D, E	protein	444	Danio rerio	O93430 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>7M6M_1 Glycine receptor subunit alphaZ1 (chains A, B, C, D, E)
MFALGIYLWETIVFFSLAASQQAAARKAASPMPPSEFLDKLMGKVSGYDARIRPNFKGPP
VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKP
DLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQL
ESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHL
ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPK
VSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSF
AAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPL
VFLIFNIFYWITYKIIRSEDIHKQ

Ligands and cofactors

ID	Name	Formula	Copies
TCI	(6aR,10aR)-6,6,9-trimethyl-3-pentyl-6a,7,8,10a-tetrahydro-6H-benzo[c]chromen-1-…	C21 H30 O2	5

Primary citation

Structural basis for cannabinoid-induced potentiation of alpha1-glycine receptors in lipid nanodiscs. Kumar, A., Kindig, K., Rao, S. et al. Nat Commun (2022) 13:4862-4862. DOI 10.1038/s41467-022-32594-5 · PubMed

Other PDB entries of the same protein (UniProt O93430 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M6N 2.61 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine
7U2N 2.8 Å, A novel compound mimics the structural and functional effects of the full agonist…
7M6O 2.84 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine and 32uM…
6PLX 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLY 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, open state
6PM6 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Glycine in SMA, open…
6PXD 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor, Apo state
7U2M 2.9 Å, A novel compound mimics the structural and functional effects of the full agonist…
7M6Q 2.91 Å, Full length alpha1 Glycine receptor in presence of 1mM Glycine and 32uM…
6PLS 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc,…
6PLW 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLZ 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, closed…

Browse structure collections

About this viewer

MolViewer shows 7M6M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.