7NUQ: Rhinovirus 14 virion-like at pH 6.2

Name: PDB 7NUQ: Rhinovirus 14 virion-like at pH 6.2
Published: 2021-05-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

Rhinovirus 14 virion-like at pH 6.2. Determined by electron microscopy at 2.8 Å resolution. Released 19 May 2021.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Human rhinovirus 14, Rhinovirus B14
Chains: 5
Atoms: 6,439
Mol. weight: 97.36 kDa
Released: 19 May 2021

Explore 7NUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NUQ contains 35 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	18-20	3	1
β-strand	34-35	2	2
α-helix	37-39	3
α-helix	47-49	3
β-strand	56-57	2	1
β-strand	66	1	3
α-helix	67-70	4
β-strand	75-82	8	4
α-helix	94-96	3
β-strand	100-102	3	5
α-helix	110-117	8
β-strand	119-133	15	4
β-strand	148-153	6	5
β-strand	175-178	4	5
β-strand	186-188	3	4
β-strand	197-198	2	4
β-strand	203	1	6
β-strand	204	1	7
α-helix	211-212	2
β-strand	213	1	7
β-strand	223-228	6	5
α-helix	231-232	2
β-strand	239-255	17	4
α-helix	257-259	3
α-helix	275-277	3

Chain 2: 16 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	8
β-strand	21-25	5	8
β-strand	28	1	9
α-helix	29-31	3
β-strand	32-33	2	9
α-helix	34-36	3
α-helix	41-43	3
α-helix	44-46	3
α-helix	52-53	2
β-strand	54	1	9
α-helix	57-60	4
β-strand	64-65	2	9
α-helix	66-68	3
β-strand	69-71	3	10
β-strand	78-82	5	11
α-helix	84-86	3
α-helix	90-97	8
β-strand	101-111	11	9
β-strand	119-126	8	11
α-helix	132-133	2
β-strand	134	1	12
α-helix	140-143	4
α-helix	144-147	4
β-strand	154-155	2	11
β-strand	165	1	12
α-helix	166	1
α-helix	169-171	3
α-helix	178-183	6
β-strand	186-190	5	11
β-strand	196-201	6	9
β-strand	210	1	9
β-strand	215	1	6
β-strand	218-229	12	11
α-helix	230-231	2
β-strand	238-240	3	10
β-strand	241-252	12	9

Chain 3: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	23	1	4
α-helix	30-33	4
β-strand	39-40	2	4
β-strand	42	1	3
α-helix	43-46	4
β-strand	51-52	2	2
α-helix	64-67	4
β-strand	68-71	4	2
β-strand	79-84	6	13
α-helix	90-94	5
α-helix	96-102	7
β-strand	104-108	5	14
β-strand	111-117	7	2
β-strand	124-132	9	13
α-helix	137-139	3
α-helix	142-145	4
β-strand	149-154	6	13
β-strand	160-165	6	2
β-strand	174-175	2	14
β-strand	186-196	11	13
α-helix	197-198	2
β-strand	205-213	9	2
β-strand	218-222	5	14

Chain 4: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	50-53	4
β-strand	56	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	1	protein	293	Human rhinovirus 14	P03303 (AlphaFold model)
Genome polyprotein	2	protein	262	Human rhinovirus 14	P03303 (AlphaFold model)
Genome polyprotein	3	protein	236	Human rhinovirus 14	P03303 (AlphaFold model)
Genome polyprotein	4	protein	68	Human rhinovirus 14	P03303 (AlphaFold model)
Octanucleotide	C	RNA	8	Rhinovirus B14

Sequence of entity 1 (1), FASTA

>7NUQ_1 Genome polyprotein (chains 1)
ALTEGLGDELEEVIVEKTKQTVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTT
YMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKL
ELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSV
FFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHK
TLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY

Sequence of entity 2 (2), FASTA

>7NUQ_2 Genome polyprotein (chains 2)
SPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSV
CRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSG
CLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVIYNMNGTLLGN
LLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPI
TVTIAPMCTEFSGIRSKSIVPQ

Sequence of entity 3 (3), FASTA

>7NUQ_3 Genome polyprotein (chains 3)
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHT
KDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGP
ALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDT
YTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE

Sequence of entity 4 (4), FASTA

>7NUQ_4 Genome polyprotein (chains 4)
GAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDLM
LKGAPALN

Sequence of entity 5 (C), FASTA

>7NUQ_5 Octanucleotide (chains C)
UGUUUUUA

Primary citation

ICAM-1 induced rearrangements of capsid and genome prime rhinovirus 14 for activation and uncoating. Hrebik, D., Fuzik, T., Gondova, M. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2024251118 · PubMed

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
31LF 2.71 Å, HRV virion E2250A mutant
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…

Browse structure collections

About this viewer

MolViewer shows 7NUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.