7NYD: 2C9-sMAC

cryoEM structure of 2C9-sMAC. Determined by electron microscopy at 3.27 Å resolution. Released 6 Oct 2021.

Method: Electron microscopy
Resolution: 3.27 Å
Organism: Homo sapiens
Chains: 8
Atoms: 38,430
Mol. weight: 649.73 kDa
Ligands: MAN, CA, NAG, FUC
Released: 6 Oct 2021

Explore 7NYD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NYD contains 190 α-helices and 352 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 44 helices, 117 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	81
β-strand	13-14	2	82
β-strand	19-26	8	81
β-strand	32-34	3	83
β-strand	37-39	3	84
β-strand	47-50	4	84
β-strand	53-55	3	83
α-helix	57-59	3
β-strand	62-67	6	81
α-helix	71-73	3
β-strand	83-89	7	84
β-strand	90	1	83
β-strand	94-100	7	84
β-strand	101-102	2	82
β-strand	107-112	6	85
β-strand	116-117	2	86
β-strand	122	1	87
β-strand	125-130	6	85
β-strand	136	1	85
β-strand	141-146	6	86
β-strand	152-158	7	86
β-strand	164-166	3	85
α-helix	167-168	2
α-helix	170	1
β-strand	171	1	87
α-helix	172-173	2
α-helix	176-178	3
β-strand	179-187	9	86
β-strand	195-201	7	86
β-strand	209-215	7	88
β-strand	219-220	2	88
β-strand	228-236	9	88
β-strand	240-241	2	88
β-strand	244-254	11	88
β-strand	264	1	88
β-strand	271-275	5	88
β-strand	278-283	6	88
α-helix	285-292	8
α-helix	298-300	3
β-strand	304-313	10	88
β-strand	319-329	11	88
β-strand	335-338	4	89
β-strand	344	1	90
β-strand	353-358	6	89
β-strand	364	1	89
β-strand	369-377	9	90
β-strand	383-385	3	90
α-helix	386-388	3
β-strand	389-392	4	90
β-strand	400-402	3	89
β-strand	412-419	8	90
α-helix	426-428	3
β-strand	431-437	7	90
β-strand	448-449	2	91
α-helix	457	1
β-strand	458	1	92
α-helix	459	1
β-strand	463-466	4	93
β-strand	468-469	2	91
β-strand	480-487	8	94
β-strand	490-498	9	94
β-strand	499-500	2	95
β-strand	504-505	2	95
β-strand	508-511	4	93
α-helix	514-516	3
β-strand	520-529	10	94
β-strand	534-543	10	94
β-strand	545	1	92
β-strand	554-557	4	96
β-strand	564	1	97
β-strand	569-575	7	96
β-strand	580-588	9	98
α-helix	591-593	3
α-helix	598-600	3
α-helix	605-610	6
β-strand	619	1	94
α-helix	624-630	7
β-strand	633-637	5	81
α-helix	643-645	3
β-strand	754-762	9	98
β-strand	765-771	7	96
α-helix	772-773	2
β-strand	778-787	10	98
β-strand	790-793	4	98
α-helix	794-796	3
β-strand	797-800	4	98
β-strand	801	1	97
β-strand	805-810	6	99
β-strand	815-816	2	100
β-strand	821-829	9	99
β-strand	835-836	2	101
β-strand	840-843	4	100
β-strand	847-849	3	99
β-strand	869-870	2	101
β-strand	874-884	11	99
β-strand	888-895	8	100
β-strand	904-912	9	100
β-strand	916-926	11	102
β-strand	927	1	103
β-strand	936	1	103
β-strand	938-941	4	104
β-strand	949	1	102
β-strand	956-963	8	102
β-strand	974	1	66
α-helix	978-982	5
α-helix	984	1
α-helix	986-987	2
α-helix	992-1009	18
α-helix	1020-1039	20
β-strand	1042	1	105
β-strand	1048	1	105
α-helix	1055-1056	2
β-strand	1057	1	105
α-helix	1058-1072	15
α-helix	1079-1092	14
α-helix	1123-1137	15
α-helix	1138-1140	3
α-helix	1144-1161	18
α-helix	1167-1178	12
α-helix	1185-1196	12
β-strand	1199-1201	3	67
β-strand	1207-1209	3	67
α-helix	1225-1243	19
α-helix	1246-1256	11
α-helix	1269-1289	21
β-strand	1292-1299	8	104
β-strand	1304-1311	8	104
β-strand	1314	1	104
β-strand	1316-1321	6	102
β-strand	1328-1332	5	104
β-strand	1336	1	104
β-strand	1339-1349	11	102
β-strand	1359-1366	8	106
β-strand	1382-1390	9	106
β-strand	1404-1408	5	107
β-strand	1414-1416	3	106
α-helix	1418-1421	4
α-helix	1423-1426	4
β-strand	1432-1438	7	107
β-strand	1441-1446	6	107
β-strand	1455-1463	9	106
α-helix	1471-1472	2
β-strand	1473-1479	7	107
β-strand	1482-1491	10	107
β-strand	1498-1499	2	108
β-strand	1510-1511	2	108
β-strand	1516	1	109
α-helix	1517-1519	3
α-helix	1527-1535	9
β-strand	1541-1549	9	110
α-helix	1554-1556	3
β-strand	1557	1	111
β-strand	1560-1566	7	110
β-strand	1582	1	112
β-strand	1584	1	111
β-strand	1590	1	109
β-strand	1598-1603	6	110
α-helix	1604-1607	4
β-strand	1619	1	112
β-strand	1626-1629	4	110
α-helix	1641-1655	15

Chain B: 35 helices, 51 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	9-14	6
β-strand	21-26	6	54
α-helix	33-37	5
α-helix	40-43	4
β-strand	47-52	6	54
α-helix	56-58	3
β-strand	59	1	55
β-strand	62-63	2	56
α-helix	64-66	3
α-helix	68-72	5
β-strand	78-82	5	57
β-strand	85-87	3	56
β-strand	89	1	58
β-strand	90	1	55
α-helix	93-95	3
β-strand	101-105	5	57
β-strand	123-124	2	59
β-strand	130-131	2	59
α-helix	133-135	3
α-helix	147-149	3
α-helix	164	1
β-strand	165	1	60
α-helix	166	1
α-helix	171-173	3
β-strand	174-177	4	6
β-strand	182-186	5	6
β-strand	188	1	61
β-strand	199-200	2	60
α-helix	207-208	2
β-strand	209-210	2	60
α-helix	211-212	2
β-strand	215-219	5	6
β-strand	223-251	29	6
β-strand	269-306	38	6
β-strand	313	1	61
α-helix	315-323	9
α-helix	330-340	11
β-strand	343-382	40	6
β-strand	394-424	31	6
α-helix	428-435	8
α-helix	445-457	13
β-strand	460-468	9	6
α-helix	469-472	4
α-helix	479-497	19
α-helix	499-501	3
α-helix	503-505	3
α-helix	509	1
β-strand	510-513	4	62
β-strand	517	1	58
β-strand	518-521	4	62
α-helix	522-523	2
β-strand	526-527	2	63
β-strand	533-534	2	63
β-strand	544	1	64
α-helix	549-552	4
β-strand	554	1	65
α-helix	555-556	2
β-strand	561-565	5	65
α-helix	572-573	2
β-strand	574	1	64
α-helix	577-581	5
β-strand	585-589	5	65
β-strand	595	1	66
α-helix	596-597	2
α-helix	607-609	3
β-strand	610	1	67
α-helix	614-616	3
β-strand	623-624	2	68
α-helix	625-626	2
β-strand	634	1	69
β-strand	640-641	2	68
α-helix	642	1
β-strand	646-648	3	70
β-strand	649	1	69
β-strand	655-659	5	71
β-strand	662-664	3	70
β-strand	676-680	5	71
β-strand	682-684	3	72
α-helix	685-687	3
β-strand	694-695	2	73
β-strand	700-702	3	72
β-strand	706-709	4	73
β-strand	722-724	3	73
β-strand	726	1	74
β-strand	728	1	74

Chain C: 35 helices, 65 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	29
β-strand	7-8	2	30
α-helix	10-15	6
β-strand	18	1	31
β-strand	23-27	5	31
β-strand	30-32	3	30
β-strand	34	1	32
β-strand	35	1	29
α-helix	38-42	5
β-strand	46-50	5	31
α-helix	56-60	5
β-strand	67-68	2	33
α-helix	69	1
β-strand	74-75	2	33
α-helix	115-119	5
β-strand	120-122	3	6
β-strand	129-132	4	6
β-strand	134	1	34
β-strand	145-146	2	35
β-strand	155-156	2	35
β-strand	163-165	3	6
β-strand	169-199	31	6
β-strand	205-241	37	6
α-helix	242-244	3
β-strand	250	1	34
α-helix	252-259	8
α-helix	267-277	11
β-strand	280-317	38	6
β-strand	330-351	22	6
β-strand	354-356	3	6
α-helix	360-366	7
α-helix	378-387	10
β-strand	393-401	9	6
α-helix	402-405	4
α-helix	412-430	19
α-helix	432-434	3
β-strand	443-446	4	36
β-strand	450	1	32
β-strand	451-454	4	36
α-helix	455-456	2
β-strand	459-460	2	37
β-strand	466-467	2	37
β-strand	477	1	38
α-helix	478-488	11
α-helix	491-493	3
β-strand	494-498	5	39
α-helix	505-506	2
β-strand	507	1	38
α-helix	510-513	4
β-strand	518-522	5	39
α-helix	525-526	2
α-helix	527-531	5
α-helix	532-534	3
α-helix	536-538	3
β-strand	548	1	40
α-helix	549-554	6
β-strand	555	1	41
β-strand	558-560	3	41
β-strand	568	1	40
β-strand	572-574	3	42
β-strand	575-577	3	41
α-helix	578	1
β-strand	581-584	4	43
β-strand	588-591	4	42
β-strand	597-598	2	42
β-strand	603-606	4	43
β-strand	608-609	2	44
α-helix	610-614	5
β-strand	619-620	2	45
β-strand	627-628	2	44
β-strand	632-634	3	46
β-strand	635-636	2	45
α-helix	637	1
β-strand	644	1	47
β-strand	648-651	4	46
β-strand	657-658	2	46
β-strand	665	1	47
β-strand	684	1	48
β-strand	687	1	49
β-strand	690	1	49
β-strand	693	1	48
α-helix	694-695	2
α-helix	703	1
β-strand	704-708	5	50
β-strand	715-719	5	50
α-helix	720-728	9
β-strand	734-735	2	50
α-helix	748-749	2
β-strand	750	1	51
β-strand	758-760	3	52
α-helix	761	1
β-strand	766	1	51
β-strand	767-769	3	52
α-helix	770-771	2
α-helix	772-774	3
β-strand	781-786	6	53
β-strand	789-794	6	53
α-helix	795-803	9
β-strand	808-812	5	53
α-helix	815-816	2

Chain D: 20 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
β-strand	12-13	2	2
α-helix	14-23	10
β-strand	28-32	5	3
β-strand	35-37	3	2
β-strand	39-40	2	1
β-strand	51-55	5	3
β-strand	71-72	2	4
β-strand	79-80	2	4
α-helix	82-84	3
α-helix	96-98	3
β-strand	113	1	5
α-helix	114-115	2
α-helix	120-122	3
β-strand	123-126	4	6
β-strand	131-135	5	6
β-strand	137	1	7
β-strand	148-151	4	5
β-strand	154-157	4	5
α-helix	158-159	2
β-strand	162-166	5	6
β-strand	170-196	27	6
β-strand	220-252	33	6
β-strand	259	1	7
α-helix	261-268	8
α-helix	276-286	11
β-strand	289-322	34	6
β-strand	351-374	24	6
α-helix	378-385	8
α-helix	389-391	3
α-helix	392-402	11
α-helix	406	1
β-strand	407-415	9	6
α-helix	416-419	4
α-helix	428-446	19
α-helix	448-450	3
α-helix	452-454	3
β-strand	459-462	4	1
β-strand	466-470	5	1
α-helix	471-472	2
β-strand	476	1	8
β-strand	482	1	8
α-helix	490-492	3
β-strand	493	1	9
α-helix	494-500	7
β-strand	501	1	10
β-strand	506-509	4	10
β-strand	515	1	9
α-helix	524-526	3
β-strand	531-534	4	10

Chain E: 21 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	11
α-helix	12-19	8
β-strand	26-30	5	12
β-strand	35	1	11
β-strand	37	1	13
α-helix	42-44	3
β-strand	49-53	5	12
α-helix	59-62	4
α-helix	66-68	3
β-strand	71	1	14
β-strand	78	1	14
α-helix	81-83	3
α-helix	95-97	3
α-helix	110-112	3
α-helix	114	1
β-strand	115	1	15
α-helix	116	1
α-helix	119-123	5
β-strand	124-126	3	6
β-strand	133-136	4	6
β-strand	138	1	16
β-strand	149-151	3	15
β-strand	158-161	4	17
β-strand	166-169	4	17
β-strand	175-177	3	15
α-helix	178-179	2
β-strand	182-185	4	6
β-strand	190-212	23	6
β-strand	246-273	28	6
β-strand	278	1	18
β-strand	280	1	16
α-helix	282-289	8
α-helix	297-307	11
β-strand	310-338	29	6
β-strand	376-394	19	6
α-helix	398-406	9
α-helix	412-420	9
β-strand	425-433	9	6
α-helix	435-438	4
β-strand	441	1	18
α-helix	447-463	17
α-helix	466-468	3
β-strand	477-481	5	13
β-strand	484-488	5	13
β-strand	508	1	19
β-strand	513	1	20
α-helix	515-520	6
β-strand	522	1	21
β-strand	525	1	21
β-strand	527-529	3	22
β-strand	531	1	20
α-helix	536	1
β-strand	538	1	19
α-helix	542-544	3
β-strand	549-551	3	22

Chain F: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	24-27	4
β-strand	29-37	9	79
α-helix	41-44	4
α-helix	47-49	3
β-strand	54-60	7	79
β-strand	63-72	10	79
β-strand	75-83	9	79
β-strand	85	1	79
β-strand	91-92	2	79
α-helix	94-96	3
β-strand	98	1	80
β-strand	101	1	80
β-strand	104-111	8	79
β-strand	115-122	8	79
β-strand	125-132	8	79
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	79
α-helix	173-175	3
β-strand	176	1	79

Chain G: 15 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	23
α-helix	25-27	3
α-helix	29-33	5
β-strand	34	1	24
β-strand	39-43	5	24
β-strand	46-51	6	23
β-strand	62-66	5	24
α-helix	72-75	4
β-strand	84-85	2	25
β-strand	91-92	2	25
α-helix	94-96	3
α-helix	103-105	3
α-helix	126	1
β-strand	127-128	2	26
α-helix	132-134	3
β-strand	138-140	3	6
β-strand	145-147	3	6
β-strand	151	1	27
β-strand	162-163	2	26
β-strand	172-173	2	26
α-helix	174-175	2
β-strand	178-182	5	6
β-strand	186-203	18	6
β-strand	261-287	27	6
β-strand	294	1	27
α-helix	296-303	8
α-helix	311-321	11
β-strand	324-352	29	6
β-strand	393-409	17	6
α-helix	413-422	10
α-helix	431-440	10
β-strand	446-454	9	6
α-helix	455-458	4
α-helix	466-482	17
α-helix	490-493	4
β-strand	499-501	3	23
β-strand	504-506	3	23
β-strand	514	1	28
β-strand	520	1	28

Chain H: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	84-86	3	75
β-strand	90-92	3	75
α-helix	97-99	3
α-helix	108-110	3
α-helix	130-133	4
β-strand	138-139	2	6
β-strand	151	1	76
β-strand	162-165	4	77
β-strand	170-173	4	77
α-helix	174-175	2
β-strand	178-183	6	6
β-strand	188-200	13	6
β-strand	202	1	6
β-strand	267-272	6	6
β-strand	274	1	78
β-strand	275-287	13	6
β-strand	294	1	76
α-helix	296-303	8
α-helix	311-320	10
β-strand	324-336	13	6
β-strand	339	1	78
α-helix	344-347	4
α-helix	353-360	8
β-strand	404	1	78
β-strand	407-409	3	6
α-helix	413-424	12
α-helix	428-430	3
α-helix	431-440	10
β-strand	446-454	9	6
α-helix	455-458	4
α-helix	466-483	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component C8 beta chain	D	protein	537	Homo sapiens	P07358 (AlphaFold model)
Complement component C8 alpha chain	E	protein	554	Homo sapiens	P07357 (AlphaFold model)
Complement component C9	G, H	protein	538	Homo sapiens	P02748 (AlphaFold model)
Complement component C7	C	protein	821	Homo sapiens	P10643 (AlphaFold model)
Complement component C6	B	protein	913	Homo sapiens	P13671
Complement component C8 gamma chain	F	protein	182	Homo sapiens	P07360
Complement C5	A	protein	1658	Homo sapiens	P01031

Sequence of entity 1 (D), FASTA

>7NYD_1 Complement component C8 beta chain (chains D)
SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNR
PCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGS
LASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEY
ESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLH
ARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIY
EYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRN
KRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELV
TATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLAC
EVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Sequence of entity 2 (E), FASTA

>7NYD_2 Complement component C8 alpha chain (chains E)
AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTC
VRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQ
KAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPY
NFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHS
QDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMY
AKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINV
GGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSL
KYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPIL
EGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNG
GASCPGRKVQTQAC

Sequence of entity 3 (G, H), FASTA

>7NYD_3 Complement component C9 (chains G, H)
QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDA
VGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPP
CRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVAS
LIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASS
ISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD
DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCL
GYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELK
EKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDY
INEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

Sequence of entity 4 (C), FASTA

>7NYD_4 Complement component C7 (chains C)
SSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFETQSCEPTRGCPTE
EGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELTGN
GYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYN
STWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQF
INNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSE
KLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGA
GFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLK
WALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGG
WSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFP
LSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVG
EMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPE
MKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTV
CKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCDAESSKCVCREASECEEEGF
SICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ

Sequence of entity 5 (B), FASTA

>7NYD_5 Complement component C6 (chains B)
CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPIN
CLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCK
NKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLA
GEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSL
GHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMK
VLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQF
SSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSI
SLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAV
TKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS
NAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQ
PCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGY
QYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGP
SRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLC
VFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKES
CGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCAN
RKMEILHPGKCLA

Sequence of entity 6 (F), FASTA

>7NYD_6 Complement component C8 gamma chain (chains F)
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQ
GTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
RR

Sequence of entity 7 (A), FASTA

>7NYD_7 Complement C5 (chains A)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILRPRRT
LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQL
RANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWE
IQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVK
MSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWF
GKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILS
VKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDP
LIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQN
SICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDI
CPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALV
KGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQ
RYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPV
EVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSD
YKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDG
HVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQK
VCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYK
ATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYP
LDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	6
CA	Calcium ion	Ca	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
FUC	alpha-L-fucopyranose	C6 H12 O5	1

Primary citation

Structural basis of soluble membrane attack complex packaging for clearance. Menny, A., Lukassen, M.V., Couves, E.C. et al. Nat Commun (2021) 12:6086-6086. DOI 10.1038/s41467-021-26366-w · PubMed

Other PDB entries of the same protein (UniProt P07358 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OJY 2.51 Å, Crystal Structure of Human Complement Component C8
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC
6H03 5.6 Å, Open conformation of the membrane attack complex
6H04 5.6 Å, Closed conformation of the Membrane Attack Complex

Browse structure collections

About this viewer

MolViewer shows 7NYD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.