7PB8: CENP-OPQUR complex

Crystal structure of the CENP-OPQUR complex. Determined by X-ray diffraction at 3.68 Å resolution. Released 27 Apr 2022.

Method: X-ray diffraction
Resolution: 3.68 Å
Organism: Homo sapiens
Chains: 5
Atoms: 5,706
Mol. weight: 151.12 kDa
Released: 27 Apr 2022

Explore 7PB8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PB8 contains 31 α-helices and 22 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	95-104	10
α-helix	108-111	4
β-strand	114-117	4	1
β-strand	121-130	10	1
β-strand	133-143	11	1
β-strand	149	1	1
β-strand	153	1	1
α-helix	161-168	8
α-helix	173-200	28
α-helix	202-204	3
β-strand	205-210	6	2
β-strand	217-223	7	2
β-strand	232-238	7	2
β-strand	249-251	3	2
α-helix	262-277	16
α-helix	280-283	4

Chain P: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	55-73	19
β-strand	77-81	5	4
β-strand	86-87	2	4
β-strand	101-111	11	4
β-strand	114-124	11	4
β-strand	135-142	8	4
α-helix	149-160	12
α-helix	164-190	27
β-strand	195-196	2	5
β-strand	198	1	6
β-strand	200	1	6
β-strand	205-208	4	5
β-strand	217-226	10	5
β-strand	232-241	10	5
β-strand	243	1	3
α-helix	244-249	6
α-helix	259-262	4
α-helix	265-269	5
α-helix	271-282	12

Chain Q: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	155-175	21
α-helix	177-198	22
α-helix	211-215	5
α-helix	216-219	4
α-helix	224-231	8
α-helix	236-247	12
α-helix	249-265	17

Chain R: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	90-105	16
α-helix	117-119	3
α-helix	120-123	4
α-helix	131-133	3
α-helix	135-149	15

Chain U: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	318-321	4
α-helix	324-372	49
β-strand	382	1	3
α-helix	387-393	7
α-helix	395-398	4
α-helix	400-413	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere protein O	O	protein	300	Homo sapiens	Q9BU64 (AlphaFold model)
Centromere protein Q	Q	protein	137	Homo sapiens	Q7L2Z9 (AlphaFold model)
Centromere protein U	U	protein	418	Homo sapiens	Q71F23 (AlphaFold model)
Centromere protein P	P	protein	294	Homo sapiens	Q6IPU0 (AlphaFold model)
Centromere protein R	R	protein	177	Homo sapiens	Q13352

Sequence of entity 1 (O), FASTA

>7PB8_1 Centromere protein O (chains O)
MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRD
ELRAVVRHRRASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSR
GVCVCISTAFEGNLLDSYFVDLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSL
CEYLNAYSGRKYQADRLQSDFAALLTGPLQRNPLCNLLSFTYKLDPGGQSFPFCARLLYK
DLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPLHQVFASFTRKGEKLDMSLVS

Sequence of entity 2 (Q), FASTA

>7PB8_2 Centromere protein Q (chains Q)
MDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTELMTGNIQSLKNKIQILASEVE
EEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQKEILALIPNQNALLKDLDILHNSSQM
KSMSTFIEEAYKKLDAS

Sequence of entity 3 (U), FASTA

>7PB8_3 Centromere protein U (chains U)
MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGE
NEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIES
VKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAES
VTSKKTGPLSAQPSVEKENLAIESQSKTQKKGKISHDKRKKSRSKAIGSDTSDIVHIWCP
EGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLT
NLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSN
LKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG

Sequence of entity 4 (P), FASTA

>7PB8_4 Centromere protein P (chains P)
MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQL
GHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEF
QILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYR
KRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLT
KVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENNENLYFQ

Sequence of entity 5 (R), FASTA

>7PB8_5 Centromere protein R (chains R)
MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLS
NEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELE
NLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

Primary citation

Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome. Yatskevich, S., Muir, K.W., Bellini, D. et al. Science (2022) 376:844-852. DOI 10.1126/science.abn3810 · PubMed

Other PDB entries of the same protein (UniProt Q9BU64 (AlphaFold model), which also has an AlphaFold model), best resolution first:

28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
7R5S 2.83 Å, Structure of the human CCAN bound to alpha satellite DNA
7PKN 3.2 Å, Structure of the human CCAN deltaCT complex
7XHO 3.29 Å, Structure of human inner kinetochore CCAN complex
9TAW 3.54 Å, Structure of the human inner kinetochore CCAN bound to DNA
7XHN 3.71 Å, Structure of human inner kinetochore CCAN-DNA complex
9TAX 4.5 Å, Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome
7R5V 4.55 Å, Structure of the human CCAN CENP-A alpha-satellite complex
7QOO 4.6 Å, Structure of the human inner kinetochore CCAN complex
7YYH 8.9 Å, Structure of the human CCANdeltaT CENP-A alpha-satellite complex
7YWX 12.0 Å, Structure of the human CCAN CENP-A alpha-satellite complex
9TAY 15.5 Å, Structure of the human inner kinetochore CCAN bound to a di-CENP-A nucleosome

Browse structure collections

About this viewer

MolViewer shows 7PB8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.