7QQM: The PDZ domain of LRRC7 fused with ANXA2

The PDZ domain of LRRC7 fused with ANXA2. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,021
Mol. weight: 47.28 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7QQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QQM contains 22 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1445-1452	8	1
β-strand	1459-1463	5	1
β-strand	1479-1484	6	1
β-strand	1499-1503	5	1
β-strand	1506-1507	2	1
α-helix	1513-1522	10
β-strand	1526-1533	8	1
α-helix	1548-1563	16
α-helix	1569-1576	8
α-helix	1581-1595	15
α-helix	1599-1606	8
α-helix	1609-1619	11
α-helix	1622-1636	15
α-helix	1641-1650	10
α-helix	1653-1667	15
α-helix	1671-1678	8
α-helix	1681-1691	11
α-helix	1695-1698	4
α-helix	1704-1716	13
α-helix	1726-1735	10
α-helix	1738-1751	14
α-helix	1756-1763	8
α-helix	1766-1780	15
α-helix	1782-1794	13
α-helix	1801-1811	11
α-helix	1816-1827	12
α-helix	1831-1838	8
α-helix	1841-1851	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing protein 7,Annexin A2	A	protein	414	Homo sapiens	P07355 (AlphaFold model), Q96NW7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7QQM_1 Leucine-rich repeat-containing protein 7,Annexin A2 (chains A)
HMGEQFCVRIEKNPGLGFSISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQPGDKIL
QANGHSFVHMEHEKAVLLLKSFQNTVDLVIQRELTGSAYGSVKAYTNFDAERDALNIETA
IKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKT
PAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSG
DFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHL
QKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRD
KVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
2HYW 2.1 Å, Human Annexin A2 with Calcium bound

Browse structure collections

About this viewer

MolViewer shows 7QQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.