Structural basis on the interaction of Scribble PDZ domains with the Tick Born encephalitis virus (TBEV) NS5 protein. Determined by X-ray diffraction at 2.02 Å resolution. Released 31 Aug 2022.
Explore 7QSA in 3D Show helices and sheets RCSB PDB PDBe
7QSA contains 5 α-helices and 13 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-17 | 6 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 46-51 | 6 | 1 |
| α-helix | 56-60 | 5 | |
| α-helix | 66 | 1 | |
| β-strand | 67-71 | 5 | 1 |
| β-strand | 74-75 | 2 | 1 |
| α-helix | 81-89 | 9 | |
| β-strand | 95-100 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-17 | 6 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 46-51 | 6 | 1 |
| α-helix | 66 | 1 | |
| β-strand | 67-71 | 5 | 1 |
| β-strand | 74-75 | 2 | 1 |
| α-helix | 81-88 | 8 | |
| β-strand | 95-100 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 54-57 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein scribble homolog | A, B | protein | 92 | Homo sapiens | Q14160 (AlphaFold model) |
| RNA-directed RNA polymerase NS5 | C | protein | 8 | Tick-borne encephalitis virus | Q01299 |
>7QSA_1 Protein scribble homolog (chains A, B) SVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILA VNGQDVRDATHQEAVSALLRPCLELSLLVRRD
>7QSA_2 RNA-directed RNA polymerase NS5 (chains C) LRLESSII
Molecular basis of Tick Born encephalitis virus NS5 mediated subversion of apico-basal cell polarity signalling. Javorsky, A., Humbert, P.O., Kvansakul, M. Biochem J (2022) 479:1303-1315. DOI 10.1042/BCJ20220037 · PubMed
Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7QSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.