7QTP: Protein scribble homolog

Structural biology of the NS1 avian influenza protein subversion on the Scribble cell polarity module. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 Apr 2022.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Homo sapiens, H5N1 subtype
Chains: 2
Atoms: 727
Mol. weight: 13.55 kDa
Released: 6 Apr 2022

Explore 7QTP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QTP contains 3 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	725-731	7	1
β-strand	740-744	5	1
β-strand	746	1	2
β-strand	752	1	3
β-strand	755	1	3
β-strand	758-763	6	1
α-helix	768-772	5
α-helix	778	1
β-strand	779-783	5	1
β-strand	786-787	2	1
β-strand	792	1	2
α-helix	793-802	10
β-strand	807-813	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	259	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A	protein	117	Homo sapiens	Q14160 (AlphaFold model)
Non-structural protein 1	B	protein	10	H5N1 subtype	Q6B3P2

Sequence of entity 1 (A), FASTA

>7QTP_1 Protein scribble homolog (chains A)
SAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIF
ISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERM

Sequence of entity 2 (B), FASTA

>7QTP_2 Non-structural protein 1 (chains B)
KMARTIESKV

Primary citation

Structural Basis of the Avian Influenza NS1 Protein Interactions with the Cell Polarity Regulator Scribble. Javorsky, A., Humbert, P.O., Kvansakul, M. Viruses (2022) 14. DOI 10.3390/v14030583 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
8CD3 1.9 Å, Crystal structure of human Scribble PDZ1 domain in complex with human TMIGD1

Browse structure collections

About this viewer

MolViewer shows 7QTP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.