7RX9: Autoinhibited P-Rex1

Structure of autoinhibited P-Rex1. Determined by X-ray diffraction at 3.22 Å resolution. Released 10 Aug 2022.

Method: X-ray diffraction
Resolution: 3.22 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,555
Mol. weight: 70.6 kDa
Released: 10 Aug 2022

Explore 7RX9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RX9 contains 20 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	45-71	27
α-helix	72-77	6
α-helix	78-79	2
α-helix	93-100	8
α-helix	103-120	18
α-helix	132-137	6
α-helix	141-144	4
α-helix	145-162	18
α-helix	166-178	13
α-helix	188-211	24
α-helix	220-236	17
α-helix	238-255	18
β-strand	257-258	2	1
α-helix	265-267	3
β-strand	272-282	11	1
β-strand	285-294	10	1
β-strand	297-303	7	1
β-strand	468-475	8	1
α-helix	476-478	3
β-strand	479-483	5	1
α-helix	491-493	3
α-helix	496-498	3
β-strand	501-506	6	1
β-strand	511-516	6	1
α-helix	520-564	45
α-helix	566-568	3
β-strand	572-574	3	2
β-strand	581-584	4	2
β-strand	585-586	2	3
α-helix	587-597	11
α-helix	603-615	13
β-strand	619-621	3	3
β-strand	634-637	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein, Endolysin chimera	A	protein	606	Homo sapiens, Enterobacteria phage T4	P00720, Q8TCU6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RX9_1 Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein, Endolysin chimera (chains A)
GRESERQLRLRLCVLNEILGTERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKVL
FSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLL
VELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPD
HPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLL
KISAGNIQERAFFLFDNLLVYCKRKSNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTK
SPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVR
RCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRT
GTWDAYSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKT
AEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLS
TVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRY
DDGTYK

Primary citation

Structure of the metastatic factor P-Rex1 reveals a two-layered autoinhibitory mechanism. Chang, Y.G., Lupton, C.J., Bayly-Jones, C. et al. Nat Struct Mol Biol (2022) 29:767-773. DOI 10.1038/s41594-022-00804-9 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 7RX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.