7S7M: Stromelysin-1

Complex of tissue inhibitor of metalloproteinases-1 (TIMP-1) mutant (L34G/M66D/T98G/P131S/Q153N) with matrix metalloproteinase-3 catalytic domain (MMP-3cd). Determined by X-ray diffraction at 3.0 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,559
Mol. weight: 40.26 kDa
Ligands: ZN, CA
Released: 16 Mar 2022

Explore 7S7M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S7M contains 11 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	96-101	6	1
α-helix	110-125	16
β-strand	131-135	5	1
β-strand	142-147	6	1
β-strand	162-167	6	1
β-strand	178-181	4	1
β-strand	186-187	2	2
β-strand	193-194	2	2
α-helix	195-207	13
β-strand	222	1	1
α-helix	229-231	3
α-helix	236-246	11

Chain B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
α-helix	5-7	3
α-helix	8-14	7
β-strand	17-30	14	3
β-strand	35-47	13	3
β-strand	60-64	5	3
β-strand	82-90	9	3
β-strand	93-95	3	3
β-strand	102-104	3	3
α-helix	110-114	5
α-helix	115-119	5
α-helix	120-123	4
β-strand	128-131	4	4
β-strand	144-147	4	4
α-helix	149-151	3
α-helix	159-162	4
β-strand	164-170	7	5
β-strand	173-178	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromelysin-1	A	protein	173	Homo sapiens	P08254 (AlphaFold model)
Metalloproteinase inhibitor 1	B	protein	184	Homo sapiens	P01033 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7S7M_1 Stromelysin-1 (chains A)
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI
MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE
IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET

Sequence of entity 2 (B), FASTA

>7S7M_2 Metalloproteinase inhibitor 1 (chains B)
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTGYQRYEIKMTKMYKGFQALGDAADIRF
VYTPADESVCGYFHRSHNRSEEFLIAGKLQDGLLHITGCSFVAPWNSLSLAQRRGFTKTY
TVGCEECTVFSCLSIPCKLQSGTHCLWTDQLLNGSEKGFQSRHLACLPREPGLCTWQSLR
SQIA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
CA	Calcium ion	Ca	3

Primary citation

Engineering of tissue inhibitor of metalloproteinases TIMP-1 for fine discrimination between closely related stromelysins MMP-3 and MMP-10. Raeeszadeh-Sarmazdeh, M., Coban, M., Mahajan, S. et al. J Biol Chem (2022) 298:101654-101654. DOI 10.1016/j.jbc.2022.101654 · PubMed

Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HY7 1.5 Å, A carboxylic acid based inhibitor in complex with MMP3
1CIZ 1.64 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1HFS 1.7 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1CAQ 1.8 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1USN 1.8 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1C3I 1.83 Å, Human stromelysin-1 catalytic domain complexed with ro-26-2812
4G9L 1.88 Å, Structure of MMP3 complexed with NNGH inhibitor.
1G49 1.9 Å, A carboxylic acid based inhibitor in complex with MMP3
1SLM 1.9 Å, Crystal structure of fibroblast stromelysin-1: the C-truncated human proenzyme
4DPE 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor.
4JA1 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor
1B8Y 2.0 Å, X-ray structure of human stromelysin catalytic domain complexed with non-peptide…

Browse structure collections

About this viewer

MolViewer shows 7S7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.