7UL5: Inactive SSTR2

CryoEM Structure of Inactive SSTR2 bound to Nb6. Determined by electron microscopy at 3.1 Å resolution. Released 29 Jun 2022.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 2,773
Mol. weight: 61.27 kDa
Released: 29 Jun 2022

Explore 7UL5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UL5 contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	41-70	30
α-helix	78-104	27
α-helix	113-145	33
α-helix	149-151	3
α-helix	156-180	25
β-strand	181-185	5	1
β-strand	191-195	5	1
α-helix	203-213	11
α-helix	214-218	5
α-helix	219-237	19
α-helix	245-281	37
α-helix	289-314	26
α-helix	318-327	10

Chain D: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	2
β-strand	22-27	6	2
β-strand	32-33	2	3
β-strand	36-39	4	3
β-strand	51-53	3	3
β-strand	59	1	3
β-strand	71-74	4	2
β-strand	79-82	4	2
β-strand	94	1	4
β-strand	96-102	7	3
β-strand	110-113	4	3
β-strand	118	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Somatostatin receptor type 2	A	protein	414	Homo sapiens	P30874 (AlphaFold model), P41145 (AlphaFold model)
Nanobody 6	D	protein	133	Lama glama

Sequence of entity 1 (A), FASTA

>7UL5_1 Somatostatin receptor type 2 (chains A)
DYKDDDDAMGQPGNGSAFLLAPNRSHAPDHDVENLYFQGMDMADEPLNGSHTWLSIPFDL
NGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIY
ILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRY
LAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGES
GAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSVRLLSGSREKDRNLRRVTRMVSIV
VAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKK
SFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSILEVLFQ

Sequence of entity 2 (D), FASTA

>7UL5_2 Nanobody 6 (chains D)
MAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTK
YGDSVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVT
VSSHHHHHHEPEA

Primary citation

Structure determination of inactive-state GPCRs with a universal nanobody. Robertson, M.J., Papasergi-Scott, M.M., He, F. et al. Nat Struct Mol Biol (2022) 29:1188-1195. DOI 10.1038/s41594-022-00859-8 · PubMed

Other PDB entries of the same protein (UniProt P30874 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7T10 2.5 Å, CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
7XN9 2.6 Å, Crystal structure of SSTR2 and L-054,522 complex
7XNA 2.65 Å, Crystal structure of somatostatin receptor 2 (SSTR2) with peptide antagonist CYN 154806
7T11 2.7 Å, CryoEM structure of somatostatin receptor 2 in complex with Octreotide and Gi3.
7WIG 2.7 Å, Cryo-EM structure of the L-054,264-bound human SSTR2-Gi1 complex
7WIC 2.8 Å, Cryo-EM structure of the SS-14-bound human SSTR2-Gi1 complex
7XAT 2.85 Å, Structure of somatostatin receptor 2 bound with SST14.
7XAV 2.87 Å, Structure of somatostatin receptor 2 bound with lanreotide.
7XAU 2.97 Å, Structure of somatostatin receptor 2 bound with octreotide.
7XMR 3.1 Å, CryoEM structure of the somatostatin receptor 2 (SSTR2) in complex with Gi1 and its…
7YAC 3.24 Å, Paltusotine-bound SSTR2-Gi complex
7Y24 3.25 Å, Cryo-EM structure of the octreotide-bound SSTR2-miniGo-scFv16 complex

Browse structure collections

About this viewer

MolViewer shows 7UL5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.