7XN7: DNA-directed RNA polymerase subunit
RNA polymerase II elongation complex containing Spt4/5, Elf1, Spt6, Spn1 and Paf1C. Determined by electron microscopy at 3.1 Å resolution. Released 7 Sept 2022.
- Method
- Electron microscopy
- Resolution
- 3.1 Å
- Organisms
- Komagataella phaffii, synthetic construct
- Chains
- 25
- Atoms
- 66,076
- Mol. weight
- 1316.11 kDa
- Ligands
- MG, ZN
- Released
- 7 Sept 2022
Explore 7XN7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7XN7 contains 417 α-helices and 361 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 81 helices, 69 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10 | 1 | |
| β-strand | 11 | 1 | 1 |
| β-strand | 16-18 | 3 | 2 |
| β-strand | 21 | 1 | 3 |
| α-helix | 22-23 | 2 | |
| α-helix | 24-30 | 7 | |
| β-strand | 34 | 1 | 4 |
| β-strand | 37 | 1 | 5 |
| α-helix | 48-49 | 2 | |
| β-strand | 52 | 1 | 5 |
| α-helix | 56-58 | 3 | |
| β-strand | 82-91 | 10 | 4 |
| α-helix | 96-105 | 10 | |
| β-strand | 106 | 1 | 6 |
| β-strand | 113 | 1 | 6 |
| α-helix | 120-127 | 8 | |
| α-helix | 131-144 | 14 | |
| β-strand | 147 | 1 | 7 |
| α-helix | 170 | 1 | |
| β-strand | 171 | 1 | 7 |
| α-helix | 172-173 | 2 | |
| β-strand | 174-178 | 5 | 8 |
| β-strand | 181-186 | 6 | 8 |
| β-strand | 199-202 | 4 | 8 |
| α-helix | 205-212 | 8 | |
| α-helix | 217-222 | 6 | |
| β-strand | 226 | 1 | 9 |
| β-strand | 230 | 1 | 9 |
| α-helix | 232-235 | 4 | |
| β-strand | 236-242 | 7 | 4 |
| β-strand | 251-252 | 2 | 10 |
| β-strand | 258-259 | 2 | 10 |
| α-helix | 262-283 | 22 | |
| α-helix | 287-305 | 19 | |
| α-helix | 313-315 | 3 | |
| β-strand | 316 | 1 | 11 |
| α-helix | 321 | 1 | |
| β-strand | 322 | 1 | 11 |
| α-helix | 323 | 1 | |
| α-helix | 326-330 | 5 | |
| α-helix | 336 | 1 | |
| α-helix | 337-341 | 5 | |
| β-strand | 344-346 | 3 | 12 |
| β-strand | 349-356 | 8 | 13 |
| β-strand | 364-368 | 5 | 13 |
| α-helix | 369-374 | 6 | |
| β-strand | 376-380 | 5 | 14 |
| α-helix | 386-395 | 10 | |
| β-strand | 403-407 | 5 | 14 |
| β-strand | 413-415 | 3 | 14 |
| α-helix | 422-424 | 3 | |
| α-helix | 427-428 | 2 | |
| β-strand | 432-436 | 5 | 14 |
| α-helix | 437 | 1 | |
| β-strand | 442-446 | 5 | 13 |
| α-helix | 453-455 | 3 | |
| β-strand | 456-464 | 9 | 13 |
| β-strand | 469-471 | 3 | 13 |
| α-helix | 473-476 | 4 | |
| β-strand | 487-491 | 5 | 13 |
| α-helix | 496-505 | 10 | |
| β-strand | 507 | 1 | 13 |
| α-helix | 508-511 | 4 | |
| β-strand | 513 | 1 | 15 |
| β-strand | 520 | 1 | 15 |
| α-helix | 527-535 | 9 | |
| β-strand | 541-542 | 2 | 16 |
| α-helix | 544-552 | 9 | |
| α-helix | 561-564 | 4 | |
| β-strand | 566-568 | 3 | 17 |
| β-strand | 572 | 1 | 17 |
| β-strand | 573-574 | 2 | 16 |
| α-helix | 575-582 | 8 | |
| α-helix | 584 | 1 | |
| β-strand | 589-591 | 3 | 18 |
| β-strand | 606-609 | 4 | 18 |
| β-strand | 612-615 | 4 | 18 |
| α-helix | 620-623 | 4 | |
| α-helix | 630-638 | 9 | |
| α-helix | 640-661 | 22 | |
| α-helix | 667-670 | 4 | |
| α-helix | 674-699 | 26 | |
| α-helix | 703-706 | 4 | |
| α-helix | 711-737 | 27 | |
| α-helix | 743-750 | 8 | |
| α-helix | 756-759 | 4 | |
| α-helix | 760-764 | 5 | |
| β-strand | 767-768 | 2 | 19 |
| β-strand | 771 | 1 | 20 |
| β-strand | 774 | 1 | 20 |
| α-helix | 795-797 | 3 | |
| β-strand | 800-801 | 2 | 19 |
| α-helix | 811-846 | 36 | |
| β-strand | 850-851 | 2 | 21 |
| β-strand | 857-858 | 2 | 21 |
| β-strand | 864-866 | 3 | 21 |
| α-helix | 869-871 | 3 | |
| β-strand | 874 | 1 | 22 |
| β-strand | 879-883 | 5 | 23 |
| α-helix | 891-898 | 8 | |
| β-strand | 914 | 1 | 24 |
| α-helix | 925-943 | 19 | |
| α-helix | 944-948 | 5 | |
| β-strand | 955-959 | 5 | 23 |
| α-helix | 962-973 | 12 | |
| α-helix | 979-980 | 2 | |
| β-strand | 981 | 1 | 24 |
| α-helix | 985-995 | 11 | |
| α-helix | 1007-1016 | 10 | |
| α-helix | 1018-1027 | 10 | |
| α-helix | 1030-1031 | 2 | |
| α-helix | 1032-1037 | 6 | |
| α-helix | 1041-1057 | 17 | |
| β-strand | 1059 | 1 | 22 |
| α-helix | 1060-1061 | 2 | |
| α-helix | 1066-1078 | 13 | |
| α-helix | 1100-1108 | 9 | |
| β-strand | 1118-1121 | 4 | 25 |
| β-strand | 1122 | 1 | 26 |
| α-helix | 1123 | 1 | |
| α-helix | 1124-1127 | 4 | |
| α-helix | 1130-1140 | 11 | |
| β-strand | 1143-1144 | 2 | 27 |
| α-helix | 1145-1148 | 4 | |
| β-strand | 1149-1156 | 8 | 28 |
| α-helix | 1169-1176 | 8 | |
| β-strand | 1193-1199 | 7 | 28 |
| α-helix | 1200 | 1 | |
| α-helix | 1201-1206 | 6 | |
| α-helix | 1211-1222 | 12 | |
| β-strand | 1226-1230 | 5 | 28 |
| β-strand | 1238-1244 | 7 | 28 |
| α-helix | 1260-1273 | 14 | |
| β-strand | 1275-1277 | 3 | 27 |
| β-strand | 1284-1295 | 12 | 25 |
| β-strand | 1301-1312 | 12 | 25 |
| α-helix | 1316-1320 | 5 | |
| β-strand | 1325 | 1 | 26 |
| β-strand | 1331-1332 | 2 | 25 |
| α-helix | 1335-1342 | 8 | |
| α-helix | 1345-1360 | 16 | |
| α-helix | 1368-1378 | 11 | |
| α-helix | 1389-1392 | 4 | |
| α-helix | 1399-1403 | 5 | |
| α-helix | 1408-1417 | 10 | |
| β-strand | 1421-1422 | 2 | 2 |
| α-helix | 1427-1432 | 6 | |
| α-helix | 1440-1442 | 3 | |
| β-strand | 1444-1448 | 5 | 29 |
| α-helix | 1452-1454 | 3 | |
Chain B: 51 helices, 81 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-27 | 14 | |
| α-helix | 32-40 | 9 | |
| α-helix | 41-45 | 5 | |
| α-helix | 46-51 | 6 | |
| β-strand | 55-62 | 8 | 30 |
| β-strand | 71-84 | 14 | 30 |
| β-strand | 88-90 | 3 | 31 |
| β-strand | 96-98 | 3 | 31 |
| α-helix | 101-107 | 7 | |
| β-strand | 112-126 | 15 | 30 |
| β-strand | 155-162 | 8 | 30 |
| α-helix | 178-182 | 5 | |
| β-strand | 194-196 | 3 | 32 |
| β-strand | 199-203 | 5 | 32 |
| α-helix | 204 | 1 | |
| β-strand | 205-209 | 5 | 33 |
| α-helix | 210 | 1 | |
| β-strand | 215-218 | 4 | 34 |
| α-helix | 219-220 | 2 | |
| β-strand | 225-234 | 10 | 34 |
| β-strand | 241-250 | 10 | 34 |
| β-strand | 261-264 | 4 | 34 |
| β-strand | 272-273 | 2 | 34 |
| α-helix | 274-281 | 8 | |
| α-helix | 286-293 | 8 | |
| α-helix | 300-313 | 14 | |
| α-helix | 319-328 | 10 | |
| α-helix | 338-350 | 13 | |
| α-helix | 365-382 | 18 | |
| α-helix | 387-390 | 4 | |
| α-helix | 394-396 | 3 | |
| β-strand | 397-400 | 4 | 33 |
| α-helix | 402-429 | 28 | |
| α-helix | 443-456 | 14 | |
| β-strand | 459 | 1 | 35 |
| α-helix | 462-464 | 3 | |
| β-strand | 469 | 1 | 35 |
| α-helix | 470 | 1 | |
| β-strand | 473-475 | 3 | 32 |
| α-helix | 481-487 | 7 | |
| β-strand | 490-492 | 3 | 33 |
| α-helix | 502-505 | 4 | |
| α-helix | 509-511 | 3 | |
| β-strand | 515 | 1 | 36 |
| α-helix | 523-525 | 3 | |
| β-strand | 529-531 | 3 | 33 |
| β-strand | 532 | 1 | 36 |
| β-strand | 537-538 | 2 | 37 |
| α-helix | 545-553 | 9 | |
| β-strand | 557-558 | 2 | 38 |
| α-helix | 559-561 | 3 | |
| β-strand | 571-575 | 5 | 38 |
| β-strand | 578-583 | 6 | 38 |
| α-helix | 586-598 | 13 | |
| β-strand | 607-611 | 5 | 38 |
| β-strand | 616-620 | 5 | 38 |
| β-strand | 626-632 | 7 | 37 |
| β-strand | 633-634 | 2 | 39 |
| β-strand | 644-645 | 2 | 39 |
| α-helix | 649-657 | 9 | |
| α-helix | 678-683 | 6 | |
| β-strand | 687-691 | 5 | 37 |
| α-helix | 694-697 | 4 | |
| β-strand | 700-701 | 2 | 37 |
| α-helix | 704-707 | 4 | |
| β-strand | 735 | 1 | 40 |
| β-strand | 740-741 | 2 | 37 |
| α-helix | 745-748 | 4 | |
| α-helix | 752-754 | 3 | |
| α-helix | 759-761 | 3 | |
| β-strand | 762 | 1 | 41 |
| α-helix | 764-773 | 10 | |
| α-helix | 774-776 | 3 | |
| β-strand | 777 | 1 | 42 |
| β-strand | 779 | 1 | 43 |
| β-strand | 792-796 | 5 | 43 |
| β-strand | 800 | 1 | 44 |
| β-strand | 804-805 | 2 | 45 |
| α-helix | 807-810 | 4 | |
| β-strand | 821-827 | 7 | 46 |
| β-strand | 838-842 | 5 | 46 |
| α-helix | 843-847 | 5 | |
| β-strand | 853-862 | 10 | 43 |
| β-strand | 865 | 1 | 47 |
| β-strand | 871 | 1 | 47 |
| β-strand | 873-874 | 2 | 48 |
| β-strand | 882-883 | 2 | 48 |
| β-strand | 893 | 1 | 49 |
| β-strand | 898 | 1 | 50 |
| β-strand | 899 | 1 | 49 |
| β-strand | 904-905 | 2 | 43 |
| β-strand | 910-912 | 3 | 50 |
| β-strand | 914-917 | 4 | 48 |
| α-helix | 922-925 | 4 | |
| β-strand | 934-936 | 3 | 48 |
| β-strand | 939-940 | 2 | 50 |
| α-helix | 941-942 | 2 | |
| β-strand | 947-956 | 10 | 43 |
| β-strand | 962-972 | 11 | 43 |
| β-strand | 979-982 | 4 | 46 |
| β-strand | 988-994 | 7 | 46 |
| α-helix | 996-998 | 3 | |
| β-strand | 1001-1002 | 2 | 51 |
| β-strand | 1010-1012 | 3 | 46 |
| α-helix | 1016-1020 | 5 | |
| β-strand | 1022 | 1 | 41 |
| α-helix | 1023-1038 | 16 | |
| β-strand | 1041-1043 | 3 | 45 |
| α-helix | 1052-1061 | 10 | |
| β-strand | 1069-1070 | 2 | 46 |
| β-strand | 1072-1073 | 2 | 51 |
| α-helix | 1079 | 1 | |
| β-strand | 1080 | 1 | 51 |
| α-helix | 1081 | 1 | |
| β-strand | 1085-1094 | 10 | 46 |
| β-strand | 1095 | 1 | 42 |
| α-helix | 1099-1101 | 3 | |
| β-strand | 1104-1106 | 3 | 13 |
| β-strand | 1111 | 1 | 52 |
| β-strand | 1118 | 1 | 52 |
| β-strand | 1128-1130 | 3 | 12 |
| α-helix | 1132-1141 | 10 | |
| α-helix | 1144-1151 | 8 | |
| β-strand | 1157-1163 | 7 | 1 |
| β-strand | 1174 | 1 | 53 |
| β-strand | 1179 | 1 | 53 |
| β-strand | 1182 | 1 | 54 |
| β-strand | 1187 | 1 | 54 |
| β-strand | 1191-1197 | 7 | 1 |
| α-helix | 1198-1209 | 12 | |
| β-strand | 1212 | 1 | 3 |
| β-strand | 1215-1217 | 3 | 2 |
Chain C: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-12 | 7 | 55 |
| β-strand | 16-22 | 7 | 55 |
| α-helix | 26-38 | 13 | |
| β-strand | 42-53 | 12 | 56 |
| α-helix | 59-67 | 9 | |
| β-strand | 71-73 | 3 | 57 |
| α-helix | 82-84 | 3 | |
| β-strand | 96-103 | 8 | 56 |
| β-strand | 111-114 | 4 | 58 |
| α-helix | 115-117 | 3 | |
| β-strand | 119-122 | 4 | 56 |
| β-strand | 129-132 | 4 | 57 |
| α-helix | 133 | 1 | |
| β-strand | 143-147 | 5 | 58 |
| β-strand | 152-162 | 11 | 56 |
| α-helix | 168-170 | 3 | |
| β-strand | 173-180 | 8 | 55 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-209 | 3 | |
| α-helix | 211-214 | 4 | |
| α-helix | 217-219 | 3 | |
| β-strand | 227-234 | 8 | 55 |
| α-helix | 240-265 | 26 | |
Chain D: 10 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 29 |
| β-strand | 24 | 1 | 59 |
| β-strand | 29 | 1 | 59 |
| α-helix | 32-34 | 3 | |
| β-strand | 37-39 | 3 | 60 |
| β-strand | 45-47 | 3 | 60 |
| β-strand | 49-51 | 3 | 29 |
| α-helix | 53-71 | 19 | |
| α-helix | 86-92 | 7 | |
| α-helix | 96-111 | 16 | |
| α-helix | 118-130 | 13 | |
| α-helix | 133-135 | 3 | |
| α-helix | 139-148 | 10 | |
| α-helix | 153-159 | 7 | |
| α-helix | 162-165 | 4 | |
| α-helix | 171-181 | 11 | |
Chain E: 13 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-24 | 22 | |
| β-strand | 27 | 1 | 61 |
| α-helix | 31-34 | 4 | |
| α-helix | 38-45 | 8 | |
| α-helix | 54-56 | 3 | |
| β-strand | 59-61 | 3 | 62 |
| β-strand | 63 | 1 | 61 |
| α-helix | 65-70 | 6 | |
| β-strand | 77-81 | 5 | 62 |
| β-strand | 86-87 | 2 | 63 |
| α-helix | 89-101 | 13 | |
| β-strand | 106-111 | 6 | 62 |
| β-strand | 114-115 | 2 | 63 |
| α-helix | 117-121 | 5 | |
| β-strand | 130-135 | 6 | 62 |
| α-helix | 137-139 | 3 | |
| α-helix | 143-145 | 3 | |
| β-strand | 151-154 | 4 | 64 |
| α-helix | 155-156 | 2 | |
| α-helix | 157-167 | 11 | |
| α-helix | 171-173 | 3 | |
| β-strand | 176-177 | 2 | 64 |
| α-helix | 182-187 | 6 | |
| β-strand | 194-201 | 8 | 64 |
| β-strand | 205-213 | 9 | 64 |
Chain F: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 73 | 1 | 29 |
| α-helix | 76-78 | 3 | |
| β-strand | 84 | 1 | 65 |
| α-helix | 87-102 | 16 | |
| α-helix | 105-107 | 3 | |
| α-helix | 117-126 | 10 | |
| β-strand | 132-137 | 6 | 29 |
| α-helix | 138 | 1 | |
| β-strand | 143-147 | 5 | 29 |
| β-strand | 152 | 1 | 65 |
Chain G: 5 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-13 | 12 | 29 |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 38-39 | 2 | 29 |
| β-strand | 43-48 | 6 | 29 |
| α-helix | 59 | 1 | |
| β-strand | 60-61 | 2 | 29 |
| α-helix | 62 | 1 | |
| β-strand | 68-79 | 12 | 29 |
| β-strand | 85-95 | 11 | 66 |
| β-strand | 98-103 | 6 | 66 |
| β-strand | 106-111 | 6 | 66 |
| α-helix | 112-114 | 3 | |
| β-strand | 120-122 | 3 | 67 |
| β-strand | 129-131 | 3 | 67 |
| β-strand | 136-137 | 2 | 67 |
| β-strand | 142-152 | 11 | 66 |
| β-strand | 157-162 | 6 | 66 |
| β-strand | 169-170 | 2 | 66 |
Chain H: 4 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-16 | 13 | 17 |
| β-strand | 23-30 | 8 | 17 |
| β-strand | 37-43 | 7 | 17 |
| β-strand | 54-60 | 7 | 17 |
| α-helix | 80-82 | 3 | |
| α-helix | 88-91 | 4 | |
| β-strand | 94-105 | 12 | 17 |
| β-strand | 111-117 | 7 | 17 |
| β-strand | 120-126 | 7 | 17 |
| α-helix | 128-131 | 4 | |
| α-helix | 132-134 | 3 | |
| β-strand | 138-144 | 7 | 17 |
14 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA-directed RNA polymerase subunit | A | protein | 1743 | Komagataella phaffii | C4R4Y0 |
| DNA-directed RNA polymerase subunit beta | B | protein | 1227 | Komagataella phaffii | C4QZQ7 (AlphaFold model) |
| RNA polymerase II third largest subunit B44, part of central core | C | protein | 304 | Komagataella phaffii | C4R7L2 (AlphaFold model) |
| RNA polymerase II subunit B32 | D | protein | 186 | Komagataella phaffii | C4R2U9 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC1 | E | protein | 214 | Komagataella phaffii | F2QX94 |
| RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III | F | protein | 155 | Komagataella phaffii | C4R1V1 |
| RNA polymerase II subunit | G | protein | 171 | Komagataella phaffii | C4R9A1 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 145 | Komagataella phaffii | C4R273 |
| DNA-directed RNA polymerase subunit | I | protein | 115 | Komagataella phaffii | F2QPE6 |
| RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III | J | protein | 72 | Komagataella phaffii | C4R009 |
| RNA polymerase II subunit B12.5 | K | protein | 118 | Komagataella phaffii | C4R3Z5 |
| RNA polymerase subunit ABC10-alpha | L | protein | 72 | Komagataella phaffii | F2QMI1 |
13 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>7XN7_1 DNA-directed RNA polymerase subunit (chains A)
MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGS
IDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNP
TMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGM
KLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVL
PVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFH
VATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNL
ELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHK
RAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYN
ADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDT
FIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLS
PKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLH
NGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVS
RTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGF
ADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQR
RLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYV
DLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPV
NLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLF
QCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQ
MTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSI
EYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELD
RARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEED
QMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVM
AVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTS
RGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMG
TGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFS
PMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGY
SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYS
PTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESK
EGE
Sequence of entity 2 (B), FASTA
>7XN7_2 DNA-directed RNA polymerase subunit beta (chains B)
MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQ
PAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDME
KSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDL
YKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSR
LISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDW
QMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQE
EGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTRE
IYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYT
YSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISI
GSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSG
AISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYD
DDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLN
DTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIA
PGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEG
LKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKK
LMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAA
KLLFQELMAMNIAPRLYTERSGVSMRS
Sequence of entity 3 (C), FASTA
>7XN7_3 RNA polymerase II third largest subunit B44, part of central core (chains C)
MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADE
FISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIK
VSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEY
DPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKA
NQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDY
NAPY
Sequence of entity 4 (D), FASTA
>7XN7_4 RNA polymerase II subunit B32 (chains D)
MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLI
REALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEET
CTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNR
LEDPYK
Sequence of entity 5 (E), FASTA
>7XN7_5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFL
ANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSAN
KMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQRE
DPVARYLGLKRGQVVKIIRRSETSGRYASYRICL
Sequence of entity 6 (F), FASTA
>7XN7_6 RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III (chains F)
MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGT
IKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQI
AMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN
Sequence of entity 7 (G), FASTA
>7XN7_7 RNA polymerase II subunit (chains G)
MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGR
IIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLV
YNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI
Sequence of entity 8 (H), FASTA
>7XN7_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLA
NSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGL
LMCLEGGYKSLASLKQDNLYILIRR
Sequence of entity 9 (I), FASTA
>7XN7_9 DNA-directed RNA polymerase subunit (chains I)
MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVD
DIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE
Sequence of entity 10 (J), FASTA
>7XN7_10 RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III (chains J)
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFL
RYNPLEKKDFDS
Sequence of entity 11 (K), FASTA
>7XN7_11 RNA polymerase II subunit B12.5 (chains K)
MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVA
YKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND
Sequence of entity 12 (L), FASTA
>7XN7_12 RNA polymerase subunit ABC10-alpha (chains L)
MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYK
ARTKRMIQFDAR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 10 |
Primary citation
Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT. Ehara, H., Kujirai, T., Shirouzu, M. et al. Science (2022) 377:eabp9466-eabp9466. DOI 10.1126/science.abp9466 · PubMed
Other PDB entries of the same protein (UniProt C4R4Y0), best resolution first:
- 5XOG 3.0 Å, RNA Polymerase II elongation complex bound with Spt5 KOW5 and Elf1
- 8JH4 3.2 Å, RNA polymerase II elongation complex containing 60 bp upstream DNA loop, stalled at…
- 8YFQ 3.3 Å, Cryo EM structure of Komagataella phaffii RNAPII-Rat1-Rai1 pre-termination complex
- 7XSZ 3.4 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC115)
- 8YFR 3.4 Å, Cryo EM structure of Komagataella phaffii Rat1-Rai1 complex bound within the RNAPII cleft
- 9WMS 3.4 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
- 9II7 3.5 Å, RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome containing…
- 9WMT 3.59 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
- 7XSE 3.6 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC42)
- 9UJS 3.62 Å, RNA polymerase II elongation complex stalled at SHL(-4) of the H3-H4 octasome
- 9WMW 3.62 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
- 8JH3 3.7 Å, RNA polymerase II elongation complex containing 40 bp upstream DNA loop, stalled at…
Browse structure collections
About this viewer
MolViewer shows 7XN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.