7XSJ: Mint1/Munc18-1/syntaxin-1 complex

The structure of the Mint1/Munc18-1/syntaxin-1 complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 16 Nov 2022.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 6,400
Mol. weight: 106.61 kDa
Released: 16 Nov 2022

Explore 7XSJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XSJ contains 47 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
β-strand	29-33	5	1
α-helix	35-44	10
α-helix	47-51	5
β-strand	55-60	6	1
α-helix	65-67	3
β-strand	68	1	2
β-strand	72-77	6	1
α-helix	81-89	9
β-strand	99	1	2
β-strand	102-106	5	1
α-helix	109-111	3
α-helix	112-118	7
α-helix	122-125	4
β-strand	127-132	6	1
β-strand	138	1	3
β-strand	144-146	3	3
α-helix	154-157	4
α-helix	159-161	3
α-helix	166-182	17
β-strand	188-191	4	3
α-helix	196-215	20
β-strand	229-234	6	3
α-helix	235-237	3
α-helix	241-243	3
β-strand	248	1	4
α-helix	249-256	8
β-strand	260	1	5
β-strand	263-269	7	5
β-strand	274-280	7	5
α-helix	286-289	4
β-strand	295	1	4
α-helix	296-313	18
α-helix	327-333	7
α-helix	335-337	3
α-helix	338-356	19
α-helix	361-374	14
β-strand	376	1	6
α-helix	381	1
β-strand	382	1	6
α-helix	383	1
α-helix	386-395	10
α-helix	401-413	13
α-helix	414-416	3
β-strand	418	1	7
α-helix	420-430	11
α-helix	434-442	9
α-helix	443-446	4
β-strand	451	1	7
α-helix	459-461	3
α-helix	481-490	10
β-strand	501	1	3
β-strand	537-542	6	3
β-strand	545-546	2	8
α-helix	547-560	14
β-strand	565-569	5	3
β-strand	572-573	2	8
α-helix	575-583	9
α-helix	589-592	4

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	31-62	32
α-helix	69-105	37
α-helix	111-156	46
α-helix	162-171	10
α-helix	177-180	4
α-helix	186-211	26
α-helix	213-226	14
α-helix	229-231	3
α-helix	233-237	5
α-helix	241-243	3

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	269-270	2
α-helix	271-282	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A	protein	600	Rattus norvegicus	P61765 (AlphaFold model)
Syntaxin-1A	B	protein	249	Rattus norvegicus	P32851 (AlphaFold model)
Amyloid-beta A4 precursor protein-binding family A member 1	C	protein	83	Rattus norvegicus	O35430 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XSJ_1 Syntaxin-binding protein 1 (chains A)
GPGSEFMAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEG
ITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDAL
FNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAE
QIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILD
RGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHK
HIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDC
MKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFL
KNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQ
LSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSG
PRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS

Sequence of entity 2 (B), FASTA

>7XSJ_2 Syntaxin-1A (chains B)
GPGSEFDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEEL
MSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQ
SDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETR
HSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQ
SKARRKKIM

Sequence of entity 3 (C), FASTA

>7XSJ_3 Amyloid-beta A4 precursor protein-binding family A member 1 (chains C)
GPGSEFYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQ
SMSSQSLDKAAEDMPEAEQDLER

Primary citation

A non-canonical target-binding site in Munc18-1 domain 3b for assembling the Mint1-Munc18-1-syntaxin-1 complex. Li, W., Xing, Y., Wang, Y. et al. Structure (2023) 31:68-77.e5. DOI 10.1016/j.str.2022.11.002 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex
4JEU 3.2 Å, Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
3PUJ 3.31 Å, Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex
6LPC 3.4 Å, Crystal Structure of rat Munc18-1 with K332E/K333E mutation
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1

Browse structure collections

About this viewer

MolViewer shows 7XSJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.