Human Estrogen Receptor beta Ligand-binding Domain in Complex with (R)-2-(2-chloro-4-hydroxyphenyl)-3-(4-hydroxyphenyl)propanenitrile. Determined by X-ray diffraction at 1.89 Å resolution. Released 20 Jul 2022.
Explore 7XWQ in 3D Show helices and sheets RCSB PDB PDBe
7XWQ contains 26 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 265-275 | 11 | |
| α-helix | 276-279 | 4 | |
| α-helix | 292-314 | 23 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 354-357 | 4 | 1 |
| β-strand | 360-362 | 3 | 1 |
| α-helix | 364-367 | 4 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 422-443 | 22 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-497 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 265-275 | 11 | |
| α-helix | 276-281 | 6 | |
| α-helix | 283-285 | 3 | |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 354-357 | 4 | 2 |
| β-strand | 360-362 | 3 | 2 |
| α-helix | 364-367 | 4 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-406 | 13 | |
| α-helix | 422-443 | 22 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-496 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 605-611 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Estrogen receptor beta | A, B | protein | 247 | Homo sapiens | Q92731 (AlphaFold model) |
| SRC peptide | C, D | protein | 13 | Homo sapiens | Q15788 (AlphaFold model) |
>7XWQ_1 Estrogen receptor beta (chains A, B) GPLGSDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKK IPGFVELSLFDQVRLLESSWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKSVEGILE IFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTD ALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKSKNVVPVYDLLLEML NAHVLDD
>7XWQ_2 SRC peptide (chains C, D) SGSHKLVQLLTTT
| ID | Name | Formula | Copies |
|---|---|---|---|
| I1M | (2~{R})-2-(2-chloranyl-4-oxidanyl-phenyl)-3-(4-hydroxyphenyl)propanenitrile | C15 H12 Cl N O2 | 2 |
Evaluating the correlation of binding affinities between isothermal titration calorimetry and fragment molecular orbital method of estrogen receptor beta with diarylpropionitrile (DPN) or DPN derivatives. Handa, C., Yamazaki, Y., Yonekubo, S. et al. J Steroid Biochem Mol Biol (2022) 222:106152-106152. DOI 10.1016/j.jsbmb.2022.106152 · PubMed
Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XWQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.