7XX9: RRM2 of Human SART3

Solution structure of RRM2 of Human SART3. Determined by solution NMR. Released 30 Aug 2023.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 650
Mol. weight: 9.35 kDa
Released: 30 Aug 2023

Explore 7XX9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XX9 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	797-800	4
β-strand	802-806	5	1
α-helix	814-824	11
β-strand	827-832	6	1
β-strand	844-848	5	1
α-helix	851-861	11
β-strand	865-866	2	2
β-strand	869-870	2	2
β-strand	872-875	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Squamous cell carcinoma antigen recognized by T-cells 3	A	protein	84	Homo sapiens	Q15020 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XX9_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A)
GSHMLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQ
ASQAVMKMDGMTIKENIIKVAISN

Primary citation

Structural investigation of human U6 snRNA recognition by spliceosomal recycling factor SART3 RNA recognition motifs. Kim, I., Bang, K.M., An, S.Y. et al. FEBS J (2025). DOI 10.1111/febs.70275 · PubMed

Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CTT 1.7 Å, Crystal structure of human SART3/TIP110 NLS-mouse importin alpha complex
5JJX 2.0 Å, Crystal structure of the HAT domain of sart3
5CTQ 2.6 Å, Crystal structure of human SART3/TIP110 half-a TPR (HAT) domain
5JJW 3.01 Å, Crystal structure of the HAT domain of sart3 in complex with USP15 DUSP-UBL domain
5CTR 3.01 Å, Crystal structure of human SART3 HAT-C domain-human USP4 DUSP-UBL domain complex
5JPZ 3.04 Å, Crystal structure of HAT domain of human Squamous Cell Carcinoma Antigen Recognized By T…
2DO4 Solution structure of the RNA binding domain of squamous cell carcinoma antigen…
7XX8 Solution structure of RRM1 of Human SART3

Browse structure collections

About this viewer

MolViewer shows 7XX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.