8AS2: Arrestin2

Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30. Determined by X-ray diffraction at 3.2 Å resolution. Released 7 Jun 2023.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Phage display vector pTDisp
Chains: 4
Atoms: 6,096
Mol. weight: 92.03 kDa
Released: 7 Jun 2023

Explore 8AS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AS2 contains 26 α-helices and 76 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-43	7	1
α-helix	45-47	3
β-strand	53-63	11	4
β-strand	75-87	13	4
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	119-120	2
α-helix	124-126	3
β-strand	127-129	3	4
α-helix	130-131	2
α-helix	138-140	3
β-strand	141-150	10	4
α-helix	157-159	3
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-189	7	5
β-strand	196-203	8	5
β-strand	207-208	2	6
β-strand	214-222	9	5
β-strand	228-243	16	7
β-strand	245-258	14	7
β-strand	262	1	7
β-strand	266-274	9	5
α-helix	279-281	3
β-strand	288-290	3	4
α-helix	299	1
β-strand	300	1	4
α-helix	301-304	4
β-strand	316-329	14	7
α-helix	333-335	3
β-strand	343-348	6	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	336-337	2	1

Chain H: 4 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	8
β-strand	26-27	2	9
β-strand	33-40	8	8
α-helix	44-46	3
β-strand	47	1	10
β-strand	48-55	8	11
β-strand	59-67	9	11
β-strand	72-75	4	11
β-strand	83-88	6	8
β-strand	93-98	6	8
α-helix	103-105	3
β-strand	107-113	7	11
β-strand	115	1	10
β-strand	124-125	2	11
β-strand	129-131	3	11
β-strand	132-133	2	9
α-helix	137-138	2
β-strand	142-146	5	12
β-strand	154	1	12
β-strand	157-165	9	12
β-strand	173-176	4	13
β-strand	181	1	13
β-strand	186-187	2	12
α-helix	188-190	3
β-strand	191-192	2	12
β-strand	198-207	10	12
β-strand	211	1	14
β-strand	214	1	14
β-strand	217-222	6	13
β-strand	227-228	2	13
β-strand	231-232	2	13

Chain L: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	15
β-strand	23-26	4	16
β-strand	33-38	6	15
β-strand	46-51	6	16
β-strand	58-62	5	16
β-strand	66-67	2	16
α-helix	68	1
β-strand	75-80	6	15
β-strand	83-88	6	15
α-helix	93-95	3
β-strand	98-103	6	16
α-helix	109	1
β-strand	111	1	16
β-strand	115-119	5	16
β-strand	124	1	17
α-helix	125-126	2
β-strand	129-131	3	18
α-helix	132-134	3
α-helix	135-140	6
β-strand	142-152	11	18
β-strand	153	1	17
β-strand	160-163	4	19
β-strand	167	1	19
β-strand	172-173	2	18
β-strand	176	1	18
α-helix	177-180	4
β-strand	186-195	10	18
α-helix	196-200	5
β-strand	205-208	4	19
β-strand	219-222	4	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	359	Homo sapiens	P49407 (AlphaFold model)
C-C chemokine receptor type 5	B	protein	22	Homo sapiens	P51681 (AlphaFold model)
Fab30 heavy chain	H	protein	233	Phage display vector pTDisp
Fab30 light chain	L	protein	220	Phage display vector pTDisp

Sequence of entity 1 (A), FASTA

>8AS2_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFLAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEE

Sequence of entity 2 (B), FASTA

>8AS2_2 C-C chemokine receptor type 5 (chains B)
APERASSVYTRSTGEQEISVGL

Sequence of entity 3 (H), FASTA

>8AS2_3 Fab30 heavy chain (chains H)
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYA
DSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 4 (L), FASTA

>8AS2_4 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECEISEV

Primary citation

A key GPCR phosphorylation motif discovered in arrestin2⋅CCR5 phosphopeptide complexes. Isaikina, P., Petrovic, I., Jakob, R.P. et al. Mol Cell (2023) 83:2108. DOI 10.1016/j.molcel.2023.05.002 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin

Browse structure collections

About this viewer

MolViewer shows 8AS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.