9LY2: Beta-arrestin-1

A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation). Determined by electron microscopy at 3.1 Å resolution. Released 4 Mar 2026.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Homo sapiens, synthetic construct
Chains: 5
Atoms: 8,867
Mol. weight: 154.97 kDa
Released: 4 Mar 2026

Explore 9LY2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LY2 contains 38 α-helices and 69 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
α-helix	30	1
β-strand	34	1	3
β-strand	37-42	6	1
α-helix	45-48	4
β-strand	52-62	11	4
α-helix	66-68	3
β-strand	76-85	10	4
α-helix	96-98	3
α-helix	99-108	10
β-strand	113-117	5	1
β-strand	127-129	3	4
α-helix	130-131	2
α-helix	139	1
β-strand	141-151	11	4
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-186	4	5
β-strand	199-203	5	5
β-strand	207-208	2	6
β-strand	214-221	8	5
β-strand	228	1	7
β-strand	230-241	12	8
β-strand	247-258	12	8
β-strand	262	1	7
β-strand	267-274	8	5
α-helix	279-281	3
β-strand	288-290	3	4
α-helix	291-292	2
β-strand	300	1	4
α-helix	301-303	3
β-strand	317-328	12	8
β-strand	343-349	7	8
β-strand	350-351	2	6
α-helix	353-356	4

Chain C: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	9
β-strand	9-10	2	10
β-strand	14-15	2	11
β-strand	21-26	6	10
β-strand	28	1	9
β-strand	35-42	8	12
β-strand	48-55	8	12
β-strand	60-63	4	12
β-strand	72-76	5	10
β-strand	81-86	6	10
α-helix	91-93	3
β-strand	95-97	3	13
β-strand	98-103	6	12
β-strand	113	1	12
α-helix	114-116	3
β-strand	117-119	3	13
β-strand	120-121	2	11
β-strand	130-133	4	14
β-strand	146-155	10	14
β-strand	161-164	4	15
α-helix	165-167	3
β-strand	173-175	3	14
α-helix	176-178	3
β-strand	179	1	14
β-strand	186-194	9	14
β-strand	206-210	5	15
β-strand	215-218	4	15

Chain E: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	16
β-strand	11-14	4	17
β-strand	19-26	8	16
β-strand	34-39	6	17
β-strand	46-50	5	17
β-strand	54-55	2	17
α-helix	56	1
β-strand	64-68	5	16
β-strand	71-78	8	16
α-helix	81-83	3
β-strand	86-91	6	17
β-strand	98-99	2	17
β-strand	103-107	5	17
α-helix	113-116	4
β-strand	117-119	3	18
α-helix	120-122	3
α-helix	123-127	5
β-strand	130-140	11	18
β-strand	147-151	5	19
β-strand	161-165	5	18
α-helix	166-168	3
β-strand	174-183	10	18
α-helix	184-189	6
β-strand	192-197	6	19
β-strand	206-211	6	19

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-32	30

Chain R: 14 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	34-54	21
α-helix	129-132	4
α-helix	174-176	3
α-helix	178-211	34
α-helix	218-244	27
α-helix	278-310	33
α-helix	317-346	30
α-helix	359-382	24
α-helix	383-387	5
α-helix	404-417	14
α-helix	419-424	6
α-helix	437-456	20
α-helix	457-461	5
α-helix	464-470	7
β-strand	520-523	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B	protein	391	Homo sapiens	P49407 (AlphaFold model)
Fab30H	C	protein	237	synthetic construct
Fab30L	E	protein	213	synthetic construct
La-pth	L	protein	36	synthetic construct
Parathyroid hormone/parathyroid hormone-related peptide receptor,Vasopressin V2 receptor	R	protein	507	Homo sapiens	P30518 (AlphaFold model), Q03431 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9LY2_1 Beta-arrestin-1 (chains B)
MKGTRVFKKASCNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFR
YGREDLDVLGLTFRKDLFCANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPN
LPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQP
TAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADIC
LFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLCNNREKRGLALDGKLKHEDTNLAS
STLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPH
REVPENETPVDTNLIELDTNDDDAAAEDFAR

Sequence of entity 2 (C), FASTA

>9LY2_2 Fab30H (chains C)
MEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYC
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHH

Sequence of entity 3 (E), FASTA

>9LY2_3 Fab30L (chains E)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFPP
SDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE

Sequence of entity 4 (L), FASTA

>9LY2_4 LA-PTH (chains L)
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI

Sequence of entity 5 (R), FASTA

>9LY2_5 Parathyroid hormone/parathyroid hormone-related peptide receptor,Vasopressin V2 receptor (chains R)
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGK
LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR
RCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAV
LILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQ
APPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTV
FGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLA
TKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEML
FNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHARGR
TPPSLGPQDESCTTASSSLAKDTSSGS

Primary citation

Structural basis of PTH1R-beta-arrestin core engagement reveals design principles for G-protein-biased therapeutics. Zhao, L.H., He, Q., Yuan, Q. et al. Nat Struct Mol Biol (2026) 33:868-881. DOI 10.1038/s41594-026-01806-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 9LY2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.