8ZYY: Neurotensin receptor 1

Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553 (complex 2). Determined by electron microscopy at 2.83 Å resolution. Released 9 Apr 2025.

Method: Electron microscopy
Resolution: 2.83 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 5
Atoms: 8,216
Mol. weight: 162.5 kDa
Ligands: SRW, PIO
Released: 9 Apr 2025

Explore 8ZYY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZYY contains 38 α-helices and 75 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 12 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	18-21	4	1
β-strand	25-27	3	2
β-strand	28	1	3
β-strand	33	1	3
α-helix	34-35	2
β-strand	38-41	4	1
α-helix	44-47	4
β-strand	52-62	11	4
β-strand	63-64	2	5
β-strand	74-84	11	4
α-helix	98-107	10
β-strand	111-114	4	1
α-helix	122-124	3
β-strand	126-128	3	4
α-helix	129-131	3
α-helix	137-138	2
β-strand	139-149	11	4
α-helix	159-161	3
β-strand	162-167	6	4
β-strand	168-170	3	2
α-helix	179-181	3
β-strand	182-187	6	6
β-strand	196-202	7	6
β-strand	206-208	3	7
β-strand	213-221	9	6
β-strand	226-240	15	8
β-strand	248-257	10	8
β-strand	261	1	8
β-strand	265-273	9	6
α-helix	278-280	3
β-strand	287-289	3	4
β-strand	299	1	4
α-helix	300-302	3
β-strand	316-329	14	8
α-helix	330	1
β-strand	339-348	10	8
β-strand	349-351	3	7
α-helix	352-354	3
β-strand	364	1	9

Chain D: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	10
β-strand	34-35	2	11
β-strand	40-48	9	10
β-strand	55-62	8	12
β-strand	68-74	7	12
β-strand	81-83	3	12
β-strand	92-96	5	10
β-strand	101-107	7	10
α-helix	111-113	3
β-strand	115-123	9	12
β-strand	132-133	2	12
β-strand	137-139	3	12
β-strand	140-141	2	11
β-strand	150-154	5	13
α-helix	155-156	2
β-strand	165-175	11	13
α-helix	179-180	2
β-strand	181-184	4	14
α-helix	185-187	3
β-strand	194-195	2	13
α-helix	196-198	3
β-strand	199-200	2	13
β-strand	206-215	10	13
α-helix	216-218	3
β-strand	224-229	6	14
β-strand	236-241	6	14

Chain Q: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	25-27	3	15
β-strand	31-34	4	16
β-strand	39-46	8	15
β-strand	54-59	6	16
β-strand	66-70	5	16
β-strand	74-75	2	16
α-helix	76	1
β-strand	83-87	5	15
β-strand	91-97	7	15
α-helix	101-103	3
β-strand	105-111	7	16
β-strand	114	1	9
β-strand	118-119	2	16
β-strand	120	1	15
β-strand	123-127	5	16
β-strand	135-139	5	17
α-helix	140-142	3
α-helix	143-147	5
β-strand	151-160	10	17
β-strand	171	1	18
β-strand	174	1	18
β-strand	181-184	4	17
α-helix	185-188	4
β-strand	194-202	9	17
α-helix	206-209	4
β-strand	212-217	6	19
β-strand	226-231	6	19

Chain R: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	60-87	28
β-strand	95	1	8
α-helix	101-123	23
α-helix	124-128	5
α-helix	137-171	35
α-helix	174-178	5
α-helix	182-206	25
α-helix	230-241	12
α-helix	242-246	5
α-helix	247-266	20
β-strand	288-291	4	5
β-strand	294-296	3	5
β-strand	298	1	20
α-helix	303-310	8
α-helix	312-315	4
α-helix	317-325	9
α-helix	338-365	28
β-strand	368	1	20
α-helix	369-379	11
β-strand	408-410	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B	protein	402	Homo sapiens	P49407 (AlphaFold model)
Fab30 heavy chain	D	protein	260	Homo sapiens
neurotensin peptide 8-13	L	protein	6	Homo sapiens
Fab30 light chain	Q	protein	235	Homo sapiens
Soluble cytochrome b562,Neurotensin receptor type 1	R	protein	557	Escherichia coli, Homo sapiens	P30989 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8ZYY_1 Beta-arrestin-1 (chains B)
MGSHHHHHHHHGSLEVLFQGPGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV
VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK
RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHV
TNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLAS
SDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTN

Sequence of entity 2 (D), FASTA

>8ZYY_2 Fab30 heavy chain (chains D)
MVSAIVLYVLLAAAAHSAFAEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWV
RQAPGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCA
RSRQFWYSGLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
VEPKSCDKTAAAHHHHHHHH

Sequence of entity 3 (L), FASTA

>8ZYY_3 neurotensin peptide 8-13 (chains L)
RRPYIL

Sequence of entity 4 (Q), FASTA

>8ZYY_4 Fab30 light chain (chains Q)
MVSAIVLYVLLAAAAHSAFASDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQK
PGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG
QGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (R), FASTA

>8ZYY_5 Soluble cytochrome b562,Neurotensin receptor type 1 (chains R)
MKTIIALSYIFCLVFAGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQK
ATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYI
QKYLASGSLEVLFQGPMRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASE
RVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYH
LGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSV
ERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVC
TPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHS
TFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHY
FYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPCFNAFSRKCDS
VSSNHTLSSNATRETLY

Ligands and cofactors

ID	Name	Formula	Copies
SRW	2-[{2-(1-fluorocyclopropyl)-4-[4-(2-methoxyphenyl)piperidin-1-yl]quinazolin-6-y…	C26 H31 F N4 O2	1
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	1

Primary citation

Molecular mechanism of the arrestin-biased agonism of neurotensin receptor 1 by an intracellular allosteric modulator. Sun, D., Li, X., Yuan, Q. et al. Cell Res (2025) 35:284-295. DOI 10.1038/s41422-025-01095-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 8ZYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.