8AS3: Arrestin2

Structure of arrestin2 in complex with 6P CCR5 phosphopeptide and Fab30. Determined by X-ray diffraction at 3.5 Å resolution. Released 7 Jun 2023.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, Phage display vector pTDisp
Chains: 4
Atoms: 6,067
Mol. weight: 92.07 kDa
Released: 7 Jun 2023

Explore 8AS3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AS3 contains 22 α-helices and 73 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-43	7	1
β-strand	53-63	11	4
β-strand	75-87	13	4
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	123-125	3
β-strand	127-129	3	4
α-helix	130-132	3
α-helix	138-140	3
β-strand	141-150	10	4
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-189	7	5
β-strand	196-203	8	5
β-strand	207-208	2	6
β-strand	214-222	9	5
β-strand	227-242	16	7
β-strand	247-258	12	7
β-strand	262	1	7
β-strand	266-274	9	5
α-helix	279-281	3
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-304	4
β-strand	316-330	15	7
α-helix	333-335	3
β-strand	343-349	7	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	341-344	4	1

Chain H: 3 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	8
β-strand	14-15	2	9
β-strand	20-28	9	8
β-strand	35-42	8	10
β-strand	50-55	6	10
β-strand	60-63	4	10
β-strand	71-76	6	8
β-strand	81-87	7	8
α-helix	91-93	3
β-strand	95-103	9	10
β-strand	112-113	2	10
β-strand	117-119	3	10
β-strand	120-121	2	9
β-strand	130-133	4	11
β-strand	142	1	11
β-strand	145-155	11	11
β-strand	161-164	4	12
α-helix	165-167	3
β-strand	169	1	12
β-strand	174-175	2	11
α-helix	176-178	3
β-strand	179-180	2	11
β-strand	186-195	10	11
β-strand	199	1	13
β-strand	202	1	13
β-strand	205	1	14
β-strand	206-209	4	12
β-strand	217	1	12
β-strand	220	1	14

Chain L: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	15
β-strand	13	1	16
β-strand	20-26	7	15
β-strand	34-39	6	17
β-strand	46-50	5	17
β-strand	54-55	2	17
α-helix	56	1
β-strand	63-68	6	15
β-strand	71-76	6	15
β-strand	86-91	6	17
α-helix	97	1
β-strand	98-99	2	17
β-strand	103-104	2	17
β-strand	106	1	16
α-helix	112-114	3
β-strand	117-119	3	18
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	18
β-strand	148-151	4	19
β-strand	154-155	2	19
β-strand	160-164	5	18
α-helix	165-168	4
β-strand	174-183	10	18
α-helix	184-188	5
β-strand	194-197	4	19
β-strand	206-209	4	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	359	Homo sapiens	P49407 (AlphaFold model)
C-C chemokine receptor type 5	B	protein	21	Homo sapiens	P51681 (AlphaFold model)
Fab30 heavy chain	H	protein	233	Phage display vector pTDisp
Fab30 light chain	L	protein	220	Phage display vector pTDisp

Sequence of entity 1 (A), FASTA

>8AS3_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFLAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEE

Sequence of entity 2 (B), FASTA

>8AS3_2 C-C chemokine receptor type 5 (chains B)
APERASSVYTRSTGEQEISVG

Sequence of entity 3 (H), FASTA

>8AS3_3 Fab30 heavy chain (chains H)
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYA
DSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 4 (L), FASTA

>8AS3_4 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECEISEV

Primary citation

A key GPCR phosphorylation motif discovered in arrestin2⋅CCR5 phosphopeptide complexes. Isaikina, P., Petrovic, I., Jakob, R.P. et al. Mol Cell (2023) 83:2108. DOI 10.1016/j.molcel.2023.05.002 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin

Browse structure collections

About this viewer

MolViewer shows 8AS3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.