8B87: Protein scribble homolog

Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Oct 2023.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Human papillomavirus type 16
Chains: 4
Atoms: 1,715
Mol. weight: 28.77 kDa
Ligands: SDY
Released: 18 Oct 2023

Explore 8B87 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8B87 contains 10 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	723-725	3
β-strand	727-732	6	1
β-strand	740-744	5	1
β-strand	748	1	2
α-helix	749-750	2
β-strand	752	1	3
β-strand	755	1	3
β-strand	758-763	6	1
α-helix	768-771	4
α-helix	778	1
β-strand	779-783	5	1
β-strand	786-787	2	1
α-helix	793-801	9
β-strand	806-812	7	1

Chains C and D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	99	1	2
β-strand	102-104	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A, B	protein	120	Homo sapiens	Q14160 (AlphaFold model)
Protein E6	C, D	protein	10	Human papillomavirus type 16	P03126 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8B87_1 Protein scribble homolog (chains A, B)
GPLGSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDD
EGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER

Sequence of entity 2 (C, D), FASTA

>8B87_2 Protein E6 (chains C, D)
SSRTRRETQL

Ligands and cofactors

ID	Name	Formula	Copies
SDY	beta-D-talopyranose	C6 H12 O6	1

Water and common crystallization additives (NH4, PEG) are not listed.

Primary citation

Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide. Stewart, B.Z., Caria, S., Humbert, P.O. et al. To be published.

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…

Browse structure collections

About this viewer

MolViewer shows 8B87 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.