8BJ0: Scribble PDZ1 with PTHR

Crystal structure of Scribble PDZ1 with PTHR. Determined by X-ray diffraction at 2.6 Å resolution. Released 15 Nov 2023.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 739
Mol. weight: 11.17 kDa
Released: 15 Nov 2023

Explore 8BJ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BJ0 contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1002-1007	6	1
β-strand	1016-1020	5	1
β-strand	1036-1041	6	1
α-helix	1046-1049	4
β-strand	1057-1061	5	1
β-strand	1064	1	1
α-helix	1071-1079	9
β-strand	1085-1090	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	590-592	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A	protein	96	Homo sapiens	Q14160 (AlphaFold model)
Parathyroid hormone/parathyroid hormone-related peptide receptor	B	protein	8	Homo sapiens	Q03431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8BJ0_1 Protein scribble homolog (chains A)
GPLGSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGD
RILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD

Sequence of entity 2 (B), FASTA

>8BJ0_2 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains B)
QEEWETVM

Primary citation

Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide. Stewart, B.Z., Caria, S., Humbert, P.O. et al. To be published.

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…

Browse structure collections

About this viewer

MolViewer shows 8BJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.