8CQY: PTPN3 PDZ domain

Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 10 May 2023.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 808
Mol. weight: 14.22 kDa
Released: 10 May 2023

Explore 8CQY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CQY contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
β-strand	23-28	6	1
α-helix	29-31	3
β-strand	33-40	8	1
α-helix	45-48	4
α-helix	52-53	2
α-helix	57	1
β-strand	58-62	5	1
β-strand	65-66	2	1
α-helix	72-81	10
β-strand	90-96	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-5	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 3	A	protein	114	Homo sapiens	P26045 (AlphaFold model)
Disintegrin and metalloproteinase domain-containing protein 17	B	protein	12	Homo sapiens	P78536 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8CQY_1 Tyrosine-protein phosphatase non-receptor type 3 (chains A)
GAMGSSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPE
SPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR

Sequence of entity 2 (B), FASTA

>8CQY_2 Disintegrin and metalloproteinase domain-containing protein 17 (chains B)
RQNRVDSKETEC

Primary citation

Interactions of the protein tyrosine phosphatase PTPN3 with viral and cellular partners through its PDZ domain: insights into structural determinants and phosphatase activity. Genera, M., Colcombet-Cazenave, B., Croitoru, A. et al. Front Mol Biosci (2023) 10:1192621-1192621. DOI 10.3389/fmolb.2023.1192621 · PubMed

Other PDB entries of the same protein (UniProt P26045 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RI5 1.26 Å, Crystal structure of PTPN3 (PTPH1) D811E mutant in complex with metavanadate
2B49 1.54 Å, Crystal Structure of the Catalytic Domain of Protein Tyrosine Phosphatase, non-receptor…
4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
4RI4 1.6 Å, Crystal structure of PTPN3 (PTPH1) Y676I mutant in complex with vanadate
4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
4QUN 1.86 Å, Crystal structure of the PTPN3 (PTPH1) catalytic domain C842S mutant
6T36 1.86 Å, Crystal structure of the PTPN3 PDZ domain bound to the HBV core protein C-terminal peptide
8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
6HKS 2.19 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal…
4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide

Browse structure collections

About this viewer

MolViewer shows 8CQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.