Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta. Determined by X-ray diffraction at 2.15 Å resolution. Released 7 Feb 2024.
Explore 8CR5 in 3D Show helices and sheets RCSB PDB PDBe
8CR5 contains 9 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-27 | 4 | 1 |
| β-strand | 30-36 | 7 | 1 |
| α-helix | 42-43 | 2 | |
| β-strand | 44-49 | 6 | 2 |
| β-strand | 59-62 | 4 | 1 |
| β-strand | 70-71 | 2 | 1 |
| β-strand | 74-79 | 6 | 2 |
| α-helix | 82-84 | 3 | |
| β-strand | 86-92 | 7 | 1 |
| β-strand | 95-108 | 14 | 1 |
| β-strand | 111-112 | 2 | 1 |
| β-strand | 117-118 | 2 | 3 |
| β-strand | 127-129 | 3 | 3 |
| β-strand | 130 | 1 | 4 |
| β-strand | 136-143 | 8 | 3 |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 165-167 | 3 | 3 |
| α-helix | 169-171 | 3 | |
| β-strand | 173-179 | 7 | 3 |
| β-strand | 182-193 | 12 | 3 |
| α-helix | 201-202 | 2 | |
| α-helix | 205 | 1 | |
| β-strand | 206-214 | 9 | 1 |
| β-strand | 217-225 | 9 | 1 |
| α-helix | 227-230 | 4 | |
| β-strand | 231 | 1 | 4 |
| α-helix | 233-236 | 4 | |
| β-strand | 237 | 1 | 5 |
| β-strand | 243 | 1 | 6 |
| β-strand | 249-250 | 2 | 6 |
| β-strand | 254 | 1 | 5 |
| β-strand | 268-274 | 7 | 7 |
| β-strand | 294-296 | 3 | 7 |
| β-strand | 302-303 | 2 | 6 |
| β-strand | 309-316 | 8 | 7 |
| α-helix | 324-326 | 3 | |
| β-strand | 327-330 | 4 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 47-55 | 9 | 8 |
| β-strand | 60-68 | 9 | 8 |
| β-strand | 74-82 | 9 | 9 |
| β-strand | 94-101 | 8 | 9 |
| β-strand | 105-109 | 5 | 8 |
| β-strand | 120-128 | 9 | 9 |
| β-strand | 131-134 | 4 | 9 |
| α-helix | 135-137 | 3 | |
| β-strand | 138-140 | 3 | 9 |
| β-strand | 146 | 1 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-12 subunit beta | A | protein | 344 | Mus musculus | P43432 (AlphaFold model) |
| Interleukin-12 receptor subunit beta-1 | B | protein | 265 | Mus musculus | Q60837 (AlphaFold model) |
>8CR5_1 Interleukin-12 subunit beta (chains A) MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD QRDYEKYSVSCQEDVTSPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGTKHHHHHH
>8CR5_2 Interleukin-12 receptor subunit beta-1 (chains B) MGVKVLFALICIAVAEAQLGASGPGDGCCVEKTSFPEGASGSPLGPRNLSCYRVSKTDYE CSWQYDGPEDNVSHVLWCCFVPPNHTHTGQERCRYFSSGPDRTVQFWEQDGIPVLSKVNF WVESRLGNRTMKSQKISQYLYNWTKTTPPLGHIKVSQSHRQLRMDWNVSEEAGAEVQFRR RMPTTNWTLGDCGPQVNSGSGVLGDIRGSMSESCLCPSENMAQEIQIRRRRRLSSGAPGG PWSDWSMPVCVPPEVLGTKHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Structures of complete extracellular receptor assemblies mediated by IL-12 and IL-23. Bloch, Y., Felix, J., Merceron, R. et al. Nat Struct Mol Biol (2024) 31:591-597. DOI 10.1038/s41594-023-01190-6 · PubMed
Other PDB entries of the same protein (UniProt P43432 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CR5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.