8D85: Interleukin-27 subunit beta

Name: PDB 8D85: Cryo-EM structure of human IL-27 signaling complex: model containing the interaction core region
Published: 2023-03-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Cryo-EM structure of human IL-27 signaling complex: model containing the interaction core region. Determined by electron microscopy at 3.81 Å resolution. Released 29 Mar 2023.

Method: Electron microscopy
Resolution: 3.81 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,093
Mol. weight: 180.77 kDa
Ligands: NAG
Released: 29 Mar 2023

Explore 8D85 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8D85 contains 28 α-helices and 71 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	43	1	9
β-strand	65-66	2	10
β-strand	70	1	11
α-helix	91-93	3
β-strand	102-105	4	11
β-strand	107-108	2	10
β-strand	113	1	10
β-strand	118-121	4	11
β-strand	126	1	9
β-strand	132-139	8	12
α-helix	145	1
β-strand	147-152	6	12
α-helix	153-154	2
β-strand	162-166	5	13
β-strand	167-168	2	14
α-helix	176	1
β-strand	177-178	2	14
α-helix	179	1
α-helix	182	1
β-strand	183-184	2	13
β-strand	192-193	2	12
β-strand	202-204	3	15
β-strand	206-210	5	13
α-helix	219-223	5
β-strand	224-226	3	15

Chain B: 11 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29	1	16
β-strand	37-38	2	17
β-strand	45-47	3	18
β-strand	50	1	16
α-helix	52-57	6
β-strand	65-68	4	19
β-strand	73-74	2	19
α-helix	75	1
β-strand	80	1	18
β-strand	88-90	3	18
β-strand	99-101	3	20
β-strand	103-105	3	19
β-strand	113-114	2	19
β-strand	118-120	3	20
β-strand	121-122	2	17
α-helix	125-129	5
β-strand	130-137	8	21
β-strand	142-147	6	21
β-strand	157-163	7	22
β-strand	172-173	2	22
α-helix	174-175	2
β-strand	181-183	3	21
α-helix	187-188	2
β-strand	194-202	9	22
β-strand	205-208	4	22
α-helix	209-211	3
β-strand	212-214	3	22
β-strand	220-221	2	21
α-helix	222-224	3
β-strand	229-231	3	23
β-strand	239-243	5	23
α-helix	248-250	3
β-strand	255-263	9	24
β-strand	270-271	2	24
α-helix	272-273	2
α-helix	274-277	4
β-strand	283-287	5	23
β-strand	294-303	10	24
α-helix	310-313	4
β-strand	317-320	4	24

Chain C: 2 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	1
β-strand	37	1	2
β-strand	39	1	3
β-strand	43-46	4	3
β-strand	49	1	1
α-helix	59-60	2
β-strand	63-67	5	4
β-strand	77-78	2	4
β-strand	80	1	3
β-strand	89-92	4	3
β-strand	96	1	5
β-strand	102-107	6	4
β-strand	117	1	4
β-strand	120-121	2	4
β-strand	127	1	2
α-helix	130-132	3
β-strand	136-138	3	6
β-strand	144-148	5	6
β-strand	163-169	7	7
β-strand	171	1	8
β-strand	178-183	6	7
β-strand	188-191	4	6
β-strand	199	1	8
β-strand	202-207	6	7
β-strand	217	1	7

Chain D: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	43-72	30
α-helix	88-89	2
β-strand	92	1	5
α-helix	94-99	6
α-helix	104-123	20
α-helix	131-157	27
α-helix	167-178	12
α-helix	194-196	3
α-helix	197-224	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-27 subunit beta	C	protein	209	Homo sapiens	Q14213 (AlphaFold model)
Interleukin-27 subunit alpha	D	protein	243	Homo sapiens	Q8NEV9 (AlphaFold model)
Interleukin-27 receptor subunit alpha	A	protein	512	Homo sapiens	Q6UWB1 (AlphaFold model)
Interleukin-6 receptor subunit beta	B	protein	625	Homo sapiens	P40189 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8D85_1 Interleukin-27 subunit beta (chains C)
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCL
QQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYY
VQVAAQDLTDYGELSDWSLPATATMSLGK

Sequence of entity 2 (D), FASTA

>8D85_2 Interleukin-27 subunit alpha (chains D)
FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLP
DVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQ
RHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLH
SLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQPEQKLISEEDLGGEQKLISEEDLHHH
HHH

Sequence of entity 3 (A), FASTA

>8D85_3 Interleukin-27 receptor subunit alpha (chains A)
QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAI
PREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWA
PPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEK
EEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWV
GGRELSPEGITCCCSLIPSGAEWARVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIA
GSTELLVTWQPGPGEPLEHVVDWARDGDPLEKLNWVRLPPGNLSALLPGNFTVGVPYRIT
VTAVSASGLASASSVWGFREELAPLVGPTLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHY
TLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELWVTASTIAGQGPPGPILRLHLPDNT
LRWKEQKLISEEDLGGEQKLISEEDLHHHHHH

Sequence of entity 4 (B), FASTA

>8D85_4 Interleukin-6 receptor subunit beta (chains B)
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTII
NRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKM
RCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAEN
ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYR
TKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITY
EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTV
NATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVE
WTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYAD
GPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTII
GNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEEQK
LISEEDLGGEQKLISEEDLHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Structural insights into the assembly of gp130 family cytokine signaling complexes. Zhou, Y., Stevis, P.E., Cao, J. et al. Sci Adv (2023) 9:eade4395-eade4395. DOI 10.1126/sciadv.ade4395 · PubMed

Other PDB entries of the same protein (UniProt Q14213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZXK 2.2 Å, Human IL-27 in complex with neutralizing SRF388 FAb fragment
8XWY 3.4 Å, Structure of Interleukin-27
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex

Browse structure collections

About this viewer

MolViewer shows 8D85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.