8E2J: BIRC6/Smac

Cryo-EM structure of BIRC6/Smac (from local refinement 1). Determined by electron microscopy at 3.44 Å resolution. Released 15 Feb 2023.

Method: Electron microscopy
Resolution: 3.44 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,318
Mol. weight: 54.06 kDa
Released: 15 Feb 2023

Explore 8E2J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8E2J contains 9 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-64	52
α-helix	74-119	46
α-helix	122-179	58

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	13-64	52
α-helix	68-70	3
α-helix	71-118	48
α-helix	122-179	58

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	52-106	55

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Diablo IAP-binding mitochondrial protein	A, B	protein	194	Homo sapiens	Q9NR28 (AlphaFold model)
Baculoviral IAP repeat-containing protein 6	C, D	protein	57	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>8E2J_1 Diablo IAP-binding mitochondrial protein (chains A, B)
MAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLY
RQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQT
GADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEA
YLREDHHHHHHHHH

Sequence of entity 2 (C, D), FASTA

>8E2J_2 Baculoviral IAP repeat-containing protein 6 (chains C, D)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

Structures of BIRC6-client complexes provide a mechanism of SMAC-mediated release of caspases. Hunkeler, M., Jin, C.Y., Fischer, E.S. Science (2023) 379:1105-1111. DOI 10.1126/science.ade5750 · PubMed

Other PDB entries of the same protein (UniProt Q9NR28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
4TX5 1.8 Å, Crystal structure of Smac-DIABLO (in space group P65)
1G73 2.0 Å, Crystal structure of smac bound to xiap-BIR3 domain
1FEW 2.2 Å, Crystal structure of smac/diablo
1XB0 2.2 Å, Structure of the BIR domain of IAP-like protein 2
1OXQ 2.3 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
3D9U 2.3 Å, The BIR3 domain of cIAP1 in complex with the N terminal peptide from SMAC/DIABLO (AVPIAQ).
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
1XB1 2.7 Å, The Structure of the BIR domain of IAP-like protein 2
3UIJ 2.71 Å, Crystal structure of human Survivin K62Y/H80W mutant in complex with Smac/DIABLO(1-15)…
6JX6 2.81 Å, Tetrameric form of Smac
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC

Browse structure collections

About this viewer

MolViewer shows 8E2J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.