8FE1: Glycine receptor subunit alphaZ1
Alpha1/BetaB Heteromeric Glycine Receptor in 1 mM Glycine 20 uM Ivermectin State. Determined by electron microscopy at 3.0 Å resolution. Released 22 Mar 2023.
- Method
- Electron microscopy
- Resolution
- 3.0 Å
- Organism
- Danio rerio
- Chains
- 5
- Atoms
- 15,445
- Mol. weight
- 294.8 kDa
- Ligands
- IVM, D10, PLM, PX4
- Released
- 22 Mar 2023
Explore 8FE1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8FE1 contains 58 α-helices and 77 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-41 | 8 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 1 |
| β-strand | 81-93 | 13 | 1 |
| β-strand | 107-108 | 2 | 1 |
| α-helix | 109-110 | 2 | |
| α-helix | 111-115 | 5 | |
| β-strand | 122-124 | 3 | 2 |
| β-strand | 127-131 | 5 | 1 |
| β-strand | 140-144 | 5 | 1 |
| β-strand | 149-161 | 13 | 1 |
| β-strand | 173-182 | 10 | 2 |
| β-strand | 190-194 | 5 | 1 |
| β-strand | 200-202 | 3 | 1 |
| β-strand | 211-221 | 11 | 2 |
| β-strand | 224-225 | 2 | 3 |
| β-strand | 230-231 | 2 | 3 |
| β-strand | 233-242 | 10 | 2 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-263 | 11 | |
| α-helix | 264-266 | 3 | |
| α-helix | 273-294 | 22 | |
| α-helix | 306-333 | 28 | |
| α-helix | 396-443 | 48 | |
Chain B: 12 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-40 | 7 | |
| α-helix | 53 | 1 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 11 |
| β-strand | 81-93 | 13 | 11 |
| β-strand | 106-109 | 4 | 11 |
| α-helix | 111-116 | 6 | |
| β-strand | 122-124 | 3 | 12 |
| β-strand | 127-132 | 6 | 11 |
| β-strand | 140-145 | 6 | 11 |
| β-strand | 149-161 | 13 | 11 |
| β-strand | 173-182 | 10 | 12 |
| β-strand | 190-194 | 5 | 11 |
| β-strand | 200-202 | 3 | 11 |
| β-strand | 211-213 | 3 | 12 |
| β-strand | 218-221 | 4 | 12 |
| β-strand | 224-226 | 3 | 13 |
| β-strand | 229-231 | 3 | 13 |
| β-strand | 233-242 | 10 | 12 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-263 | 11 | |
| α-helix | 264-267 | 4 | |
| α-helix | 273-294 | 22 | |
| α-helix | 295-297 | 3 | |
| α-helix | 306-337 | 32 | |
| α-helix | 399-442 | 44 | |
Chain C: 11 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-40 | 7 | |
| α-helix | 53 | 1 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 8 |
| β-strand | 81-93 | 13 | 8 |
| β-strand | 106-109 | 4 | 8 |
| α-helix | 111-116 | 6 | |
| β-strand | 123-124 | 2 | 9 |
| β-strand | 127-131 | 5 | 8 |
| β-strand | 140-145 | 6 | 8 |
| β-strand | 149-161 | 13 | 8 |
| β-strand | 173-181 | 9 | 9 |
| β-strand | 190-194 | 5 | 8 |
| β-strand | 200-202 | 3 | 8 |
| β-strand | 211-213 | 3 | 9 |
| β-strand | 218-221 | 4 | 9 |
| β-strand | 224-225 | 2 | 10 |
| β-strand | 230-231 | 2 | 10 |
| β-strand | 233-242 | 10 | 9 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-263 | 11 | |
| α-helix | 264-266 | 3 | |
| α-helix | 273-296 | 24 | |
| α-helix | 306-333 | 28 | |
| α-helix | 397-443 | 47 | |
Chain D: 13 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-40 | 7 | |
| α-helix | 53 | 1 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 4 |
| β-strand | 81-93 | 13 | 4 |
| α-helix | 95-97 | 3 | |
| β-strand | 107-108 | 2 | 4 |
| α-helix | 111-116 | 6 | |
| β-strand | 122-124 | 3 | 5 |
| β-strand | 127-131 | 5 | 4 |
| β-strand | 134 | 1 | 6 |
| β-strand | 138 | 1 | 6 |
| β-strand | 140-144 | 5 | 4 |
| β-strand | 149-161 | 13 | 4 |
| β-strand | 173-182 | 10 | 5 |
| β-strand | 190-194 | 5 | 4 |
| β-strand | 200-202 | 3 | 4 |
| β-strand | 211-213 | 3 | 5 |
| β-strand | 218-221 | 4 | 5 |
| β-strand | 224-225 | 2 | 7 |
| β-strand | 230-231 | 2 | 7 |
| β-strand | 233-242 | 10 | 5 |
| α-helix | 243 | 1 | |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-263 | 11 | |
| α-helix | 264-267 | 4 | |
| α-helix | 273-294 | 22 | |
| α-helix | 306-333 | 28 | |
| α-helix | 397-443 | 47 | |
Chain E: 11 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 59-63 | 5 | |
| α-helix | 79 | 1 | |
| β-strand | 80-95 | 16 | 14 |
| β-strand | 100-112 | 13 | 14 |
| α-helix | 131-136 | 6 | |
| β-strand | 142-144 | 3 | 15 |
| β-strand | 147-151 | 5 | 14 |
| β-strand | 154 | 1 | 16 |
| β-strand | 158 | 1 | 16 |
| β-strand | 160-164 | 5 | 14 |
| β-strand | 169-181 | 13 | 14 |
| α-helix | 189-191 | 3 | |
| β-strand | 193-202 | 10 | 15 |
| β-strand | 210-214 | 5 | 14 |
| β-strand | 220-221 | 2 | 14 |
| β-strand | 230-232 | 3 | 15 |
| β-strand | 237 | 1 | 15 |
| β-strand | 244-246 | 3 | 17 |
| β-strand | 250-252 | 3 | 17 |
| β-strand | 254-263 | 10 | 15 |
| α-helix | 266-268 | 3 | |
| α-helix | 269-273 | 5 | |
| α-helix | 274-284 | 11 | |
| α-helix | 285-287 | 3 | |
| α-helix | 294-318 | 25 | |
| α-helix | 327-354 | 28 | |
| α-helix | 468-492 | 25 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Glycine receptor subunit alphaZ1 | A, B, C, D | protein | 458 | Danio rerio | O93430 (AlphaFold model) |
| Glycine receptor beta subunit 2 | E | protein | 591 | Danio rerio | Q6DC22 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>8FE1_1 Glycine receptor subunit alphaZ1 (chains A, B, C, D)
MFALGIYLWETIVFFSLAASQQAAARKAASPMPPSEFLDKLMGKVSGYDARIRPNFKGPP
VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKP
DLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQL
ESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHL
ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPK
VSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSF
AAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPL
VFLIFNIFYWITYKIIRSEDIHKQLVPRGSHHHHHHHH
Sequence of entity 2 (E), FASTA
>8FE1_2 Glycine receptor beta subunit 2 (chains E)
MKALKVIFMLLIICLWMEGGFTKEKSAKKWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGG
SGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKENLYFQGEKSAKKGKKKGKQVYC
PSQLSSEDLARVPANSTSNILNKLLITYDPRIRPNFKGIPVEDRVNIFINSFGSIQETTM
DYRVNIFLRQRWNDPRLRLPQDFKSDSLTVDPKMFKCLWKPDLFFANEKSANFHDVTQEN
ILLFIFRNGDVLISMRLSVTLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLQFMWQSGDP
VQMDEIALPQFDIKQEDIEYGNCTKYYAGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLI
VVLSWLSFWINPDASAARVPLGILSVLSLSSECTSLASELPKVSYVKAIDIWLIACLLFG
FASLVEYAVVQVMLNSPKLLEAERAKIATKEKAEGKTPAKNTINGMGSTPIHVSTLQVTE
TRCKKVCTSKSDLRTNDFSIVGSLPRDFELSNFDCYGKPIEVGSAFSKSQAKNNKKPPPP
KPVIPSAAKRIDLYARALFPFSFLFFNVIYWSVYLENLYFQGTETSQVAPA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| IVM | (2aE,4E,5'S,6S,6'R,7S,8E,11R,13R,15S,17aR,20R,20aR,20bS)-6'-[(2S)-butan-2-yl]-2… | C48 H74 O14 | 5 |
| D10 | Decane | C10 H22 | 1 |
| PLM | Palmitic acid | C16 H32 O2 | 28 |
| PX4 | 1,2-dimyristoyl-sn-glycero-3-phosphocholine | C36 H73 N O8 P | 8 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 6 |
| GLY | Glycine | C2 H5 N O2 | 5 |
Primary citation
Conformational transitions and allosteric modulation in a heteromeric glycine receptor. Gibbs, E., Klemm, E., Seiferth, D. et al. Nat Commun (2023) 14:1363-1363. DOI 10.1038/s41467-023-37106-7 · PubMed
Other PDB entries of the same protein (UniProt O93430 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7M6N 2.61 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine
- 7U2N 2.8 Å, A novel compound mimics the structural and functional effects of the full agonist…
- 7M6O 2.84 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine and 32uM…
- 6PLX 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
- 6PLY 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, open state
- 6PM6 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Glycine in SMA, open…
- 6PXD 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor, Apo state
- 7U2M 2.9 Å, A novel compound mimics the structural and functional effects of the full agonist…
- 7M6Q 2.91 Å, Full length alpha1 Glycine receptor in presence of 1mM Glycine and 32uM…
- 6PLS 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc,…
- 6PLW 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
- 6PLZ 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, closed…
Browse structure collections
About this viewer
MolViewer shows 8FE1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.