8G4X: Gamma-aminobutyric acid receptor subunit alpha-1
Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in complex with GABA and allopregnanolone. Determined by electron microscopy at 2.56 Å resolution. Released 20 Sept 2023.
- Method
- Electron microscopy
- Resolution
- 2.56 Å
- Organism
- Mus musculus
- Chains
- 7
- Atoms
- 15,898
- Mol. weight
- 337.02 kDa
- Ligands
- Y4B, NAG, ABU, PIO
- Released
- 20 Sept 2023
Explore 8G4X in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8G4X contains 66 α-helices and 106 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-22 | 11 | |
| α-helix | 30 | 1 | |
| β-strand | 38-48 | 11 | 1 |
| β-strand | 49 | 1 | 2 |
| β-strand | 52-53 | 2 | 1 |
| β-strand | 58-70 | 13 | 1 |
| α-helix | 72-74 | 3 | |
| β-strand | 82-85 | 4 | 1 |
| α-helix | 87-90 | 4 | |
| β-strand | 98-100 | 3 | 3 |
| β-strand | 103 | 1 | 1 |
| β-strand | 107-108 | 2 | 1 |
| β-strand | 112 | 1 | 4 |
| β-strand | 116-121 | 6 | 1 |
| β-strand | 125-137 | 13 | 1 |
| β-strand | 149-153 | 5 | 3 |
| β-strand | 156-158 | 3 | 3 |
| β-strand | 166-170 | 5 | 1 |
| α-helix | 174-176 | 3 | |
| β-strand | 178-180 | 3 | 1 |
| β-strand | 185 | 1 | 2 |
| β-strand | 190-203 | 14 | 3 |
| β-strand | 208-220 | 13 | 3 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-240 | 10 | |
| α-helix | 243-245 | 3 | |
| α-helix | 251-274 | 24 | |
| α-helix | 284-309 | 26 | |
| α-helix | 386-389 | 4 | |
| α-helix | 390-415 | 26 | |
Chain B: 13 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-20 | 14 | |
| α-helix | 35 | 1 | |
| β-strand | 36-41 | 6 | 5 |
| β-strand | 43 | 1 | 6 |
| β-strand | 44-51 | 8 | 5 |
| β-strand | 56-68 | 13 | 5 |
| α-helix | 70-72 | 3 | |
| β-strand | 81-83 | 3 | 5 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 7 |
| β-strand | 101-106 | 6 | 5 |
| β-strand | 110 | 1 | 3 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 123-135 | 13 | 5 |
| α-helix | 140-142 | 3 | |
| β-strand | 147-156 | 10 | 7 |
| β-strand | 164-168 | 5 | 5 |
| α-helix | 171-173 | 3 | |
| β-strand | 176 | 1 | 6 |
| β-strand | 183 | 1 | 7 |
| β-strand | 186-200 | 15 | 7 |
| β-strand | 203-216 | 14 | 7 |
| α-helix | 218-221 | 4 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-241 | 15 | |
| α-helix | 247-271 | 25 | |
| α-helix | 278-279 | 2 | |
| α-helix | 280-306 | 27 | |
| α-helix | 459-486 | 28 | |
Chain C: 10 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-47 | 10 | |
| β-strand | 63-73 | 11 | 22 |
| β-strand | 74 | 1 | 23 |
| β-strand | 77-78 | 2 | 22 |
| β-strand | 83-95 | 13 | 22 |
| α-helix | 97-99 | 3 | |
| β-strand | 107-110 | 4 | 22 |
| α-helix | 112-117 | 6 | |
| β-strand | 123-125 | 3 | 10 |
| β-strand | 128-133 | 6 | 22 |
| β-strand | 137 | 1 | 7 |
| β-strand | 141-146 | 6 | 22 |
| β-strand | 150-162 | 13 | 22 |
| α-helix | 167-169 | 3 | |
| β-strand | 174-183 | 10 | 10 |
| β-strand | 191-195 | 5 | 22 |
| β-strand | 203-205 | 3 | 22 |
| β-strand | 210 | 1 | 23 |
| β-strand | 215-229 | 15 | 10 |
| β-strand | 232-245 | 14 | 10 |
| α-helix | 248-250 | 3 | |
| α-helix | 251-255 | 5 | |
| α-helix | 256-267 | 12 | |
| α-helix | 276-300 | 25 | |
| α-helix | 309-334 | 26 | |
| α-helix | 426-452 | 27 | |
Chain D: 11 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-35 | 10 | |
| α-helix | 43 | 1 | |
| β-strand | 51-66 | 16 | 8 |
| β-strand | 71-83 | 13 | 8 |
| α-helix | 85-87 | 3 | |
| β-strand | 95-98 | 4 | 8 |
| α-helix | 100-105 | 6 | |
| β-strand | 111-112 | 2 | 9 |
| β-strand | 116-121 | 6 | 8 |
| β-strand | 125 | 1 | 10 |
| β-strand | 129-134 | 6 | 8 |
| β-strand | 138-150 | 13 | 8 |
| β-strand | 162-165 | 4 | 11 |
| β-strand | 168-169 | 2 | 12 |
| β-strand | 170-171 | 2 | 9 |
| β-strand | 179-188 | 10 | 8 |
| α-helix | 193-195 | 3 | |
| β-strand | 201-208 | 8 | 11 |
| β-strand | 211-215 | 5 | 13 |
| β-strand | 218-222 | 5 | 13 |
| β-strand | 223-224 | 2 | 12 |
| β-strand | 225-231 | 7 | 11 |
| α-helix | 233-236 | 4 | |
| α-helix | 237-241 | 5 | |
| α-helix | 242-256 | 15 | |
| α-helix | 262-285 | 24 | |
| α-helix | 295-318 | 24 | |
| α-helix | 411-431 | 21 | |
Chain E: 13 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-20 | 14 | |
| α-helix | 28 | 1 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 14 |
| β-strand | 56-68 | 13 | 14 |
| α-helix | 70-72 | 3 | |
| β-strand | 81 | 1 | 14 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 4 |
| β-strand | 101-106 | 6 | 14 |
| β-strand | 110 | 1 | 9 |
| β-strand | 114-118 | 5 | 14 |
| β-strand | 123-135 | 13 | 14 |
| α-helix | 140-142 | 3 | |
| β-strand | 147-156 | 10 | 4 |
| β-strand | 164-168 | 5 | 14 |
| β-strand | 176 | 1 | 14 |
| β-strand | 186-200 | 15 | 4 |
| β-strand | 203-216 | 14 | 4 |
| α-helix | 218-221 | 4 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 237-241 | 5 | |
| α-helix | 247-271 | 25 | |
| α-helix | 280-306 | 27 | |
| α-helix | 460-487 | 28 | |
Chain H: 3 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 15 |
| β-strand | 10-12 | 3 | 16 |
| β-strand | 17-23 | 7 | 15 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 17 |
| β-strand | 46-52 | 7 | 17 |
| β-strand | 56-59 | 4 | 17 |
| α-helix | 61-63 | 3 | |
| β-strand | 64 | 1 | 15 |
| β-strand | 67-72 | 6 | 15 |
| β-strand | 77-82A | 7 | 15 |
| α-helix | 84-86 | 3 | |
| β-strand | 89-94 | 6 | 17 |
| β-strand | 103 | 1 | 17 |
| β-strand | 107-108 | 2 | 17 |
| β-strand | 109-111 | 3 | 16 |
Chain L: 3 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-5 | 2 | 18 |
| β-strand | 10 | 1 | 19 |
| α-helix | 13-14 | 2 | |
| β-strand | 19-23 | 5 | 20 |
| β-strand | 24-25 | 2 | 18 |
| β-strand | 33-38 | 6 | 21 |
| β-strand | 45-49 | 5 | 21 |
| β-strand | 53-54 | 2 | 21 |
| β-strand | 62-67 | 6 | 20 |
| β-strand | 70-75 | 6 | 20 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 21 |
| β-strand | 96-97 | 2 | 21 |
| α-helix | 98-100 | 3 | |
| β-strand | 101 | 1 | 21 |
| β-strand | 102 | 1 | 19 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit alpha-1 | A | protein | 455 | Mus musculus | P62812 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit beta-2 | B, E | protein | 512 | Mus musculus | P63137 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit gamma-2 | D | protein | 474 | Mus musculus | P22723 (AlphaFold model) |
| Heavy Chain of 8E3 Fab | H | protein | 223 | Mus musculus | |
| Light Chain of 8E3 Fab | L | protein | 213 | Mus musculus | |
| Gamma-aminobutyric acid receptor subunit alpha-3 | C | protein | 492 | Mus musculus | P26049 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>8G4X_1 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Sequence of entity 2 (B, E), FASTA
>8G4X_2 Gamma-aminobutyric acid receptor subunit beta-2 (chains B, E)
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
FYKDIKQNGTQYRSLWDPTGDLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD
LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
Sequence of entity 3 (D), FASTA
>8G4X_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSIGSSVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKD
CASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
Sequence of entity 4 (H), FASTA
>8G4X_4 Heavy Chain of 8E3 Fab (chains H)
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNMYWVKQSHGKSLEWIGYIDPYNADTTY
NREFKGKATLTVDKSSSTAFMHLNSLTSEDSAVYYCARKRNNFYFDYWGQGTPLTVSSAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKSAALEVLFQ
Sequence of entity 5 (L), FASTA
>8G4X_5 Light Chain of 8E3 Fab (chains L)
YIVMTQSPKSMSMSLGERVTLSCRASEYVGSYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFAGSGSATDFTLTITSVQAEDLADYHCGQTYNYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Sequence of entity 6 (C), FASTA
>8G4X_6 Gamma-aminobutyric acid receptor subunit alpha-3 (chains C)
MIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVIYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISKSAA
APSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| Y4B | allopregnanolone | C21 H34 O2 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| ABU | Gamma-amino-butanoic acid | C4 H9 N O2 | 2 |
| PIO | [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d… | C25 H49 O19 P3 | 2 |
Primary citation
Cryo-EM structures reveal native GABA A receptor assemblies and pharmacology. Sun, C., Zhu, H., Clark, S. et al. Nature (2023) 622:195-201. DOI 10.1038/s41586-023-06556-w · PubMed
Other PDB entries of the same protein (UniProt P62812 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8FOI 2.5 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
- 8G5F 2.64 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
- 8G4N 2.67 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
- 5OSA 2.75 Å, GLIC-GABAAR alpha1 chimera crystallized at pH4.6
- 8G5H 2.89 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
- 8G5G 2.94 Å, Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in…
- 8G4O 3.06 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
- 5OSC 3.1 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with pregnenolone sulfate at pH 4.5
- 5OSB 3.8 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with THDOC at pH4.5
Browse structure collections
About this viewer
MolViewer shows 8G4X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.