8G5G: Gamma-aminobutyric acid receptor subunit alpha-1

Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in complex with GABA, Zolpidem, and endogenous neurosteroid. Determined by electron microscopy at 2.94 Å resolution. Released 20 Sept 2023.

Method: Electron microscopy
Resolution: 2.94 Å
Organism: Mus musculus
Chains: 7
Atoms: 15,860
Mol. weight: 337.5 kDa
Ligands: R5R, NAG, ABU, Y4B
Released: 20 Sept 2023

Explore 8G5G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8G5G contains 60 α-helices and 113 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
α-helix	30	1
β-strand	38-48	11	1
β-strand	49	1	2
β-strand	52-53	2	1
α-helix	54-56	3
β-strand	58-70	13	1
β-strand	82-85	4	1
α-helix	87-90	4
β-strand	98-100	3	3
β-strand	103	1	1
β-strand	112	1	4
β-strand	116-121	6	1
β-strand	125-137	13	1
β-strand	150-152	3	5
β-strand	156-158	3	3
β-strand	166-169	4	1
β-strand	178-180	3	1
β-strand	185	1	2
β-strand	190-203	14	5
β-strand	208-220	13	5
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-245	15
α-helix	251-275	25
α-helix	282-283	2
α-helix	284-309	26
α-helix	386-389	4
α-helix	390-415	26

Chain B: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	35	1
β-strand	36-40	5	6
β-strand	43-44	2	6
β-strand	50-51	2	6
β-strand	56-65	10	6
β-strand	68	1	7
β-strand	81-83	3	8
α-helix	85-90	6
β-strand	96-98	3	9
β-strand	101	1	6
β-strand	106	1	6
β-strand	114-115	2	6
β-strand	116-118	3	8
β-strand	123	1	7
β-strand	124	1	8
β-strand	126-135	10	6
α-helix	140-142	3
β-strand	147-156	10	9
β-strand	164-168	5	6
α-helix	171-174	4
β-strand	176	1	6
β-strand	186-192	7	9
β-strand	199	1	10
β-strand	204	1	10
β-strand	207-216	10	9
α-helix	217	1
α-helix	218-221	4
α-helix	222-226	5
α-helix	227-241	15
α-helix	247-271	25
α-helix	278-279	2
α-helix	280-307	28
α-helix	459-486	28

Chain C: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	38-47	10
β-strand	63-65	3	22
β-strand	66-73	8	23
β-strand	77-78	2	24
β-strand	83-86	4	24
β-strand	87-95	9	23
β-strand	108-110	3	23
α-helix	114-117	4
β-strand	123-124	2	13
β-strand	128	1	24
β-strand	133	1	25
β-strand	141-145	5	23
β-strand	150-156	7	23
β-strand	157	1	25
β-strand	159-162	4	24
α-helix	167-169	3
β-strand	174-177	4	26
β-strand	181	1	26
β-strand	182-183	2	13
β-strand	191-193	3	22
β-strand	203-205	3	23
β-strand	215-228	14	26
β-strand	233-245	13	26
α-helix	247-250	4
α-helix	251-255	5
α-helix	256-270	15
α-helix	276-300	25
α-helix	309-333	25
α-helix	420-425	6
α-helix	426-450	25

Chain D: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
α-helix	43	1
α-helix	50	1
β-strand	51-54	4	11
β-strand	57-66	10	11
β-strand	71-83	13	11
β-strand	95-98	4	11
β-strand	111-112	2	12
β-strand	116-121	6	11
β-strand	125	1	13
β-strand	129-134	6	11
β-strand	138-150	13	11
β-strand	163-169	7	14
β-strand	170-171	2	12
β-strand	179-182	4	11
β-strand	188-190	3	11
α-helix	193-195	3
β-strand	201-214	14	14
β-strand	219-231	13	14
α-helix	236	1
α-helix	237-241	5
α-helix	242-256	15
α-helix	262-286	25
α-helix	288-289	2
α-helix	295-318	24
α-helix	411-431	21

Chain E: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	15
β-strand	56-68	13	15
α-helix	70-72	3
β-strand	81-83	3	15
α-helix	87-90	4
β-strand	96-98	3	4
β-strand	101-106	6	15
β-strand	110	1	12
β-strand	114-118	5	15
β-strand	123-134	12	15
β-strand	147	1	4
β-strand	150-156	7	4
β-strand	164-168	5	15
β-strand	175-176	2	15
β-strand	186-200	15	4
β-strand	203-216	14	4
α-helix	218-224	7
α-helix	226-238	13
α-helix	239-241	3
α-helix	247-271	25
α-helix	280-307	28
α-helix	460-486	27

Chain H: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	16
β-strand	10-12	3	17
β-strand	18-24	7	16
β-strand	34-39	6	17
β-strand	45-52	8	17
β-strand	56-59	4	17
β-strand	64	1	16
β-strand	67-72	6	16
β-strand	77-82	6	16
α-helix	84-86	3
β-strand	88-92	5	17
β-strand	95	1	18
β-strand	100A	1	18
β-strand	104	1	16
β-strand	107-111	5	17

Chain L: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	19
β-strand	10-11	2	20
α-helix	13-14	2
β-strand	19-25	7	19
β-strand	33-38	6	21
β-strand	45-49	5	21
β-strand	53-54	2	21
α-helix	55	1
β-strand	62-65	4	19
β-strand	71-75	5	19
β-strand	85-90	6	21
β-strand	96	1	21
β-strand	98	1	19
β-strand	102-103	2	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1	A	protein	455	Mus musculus	P62812 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-2	B, E	protein	512	Mus musculus	P63137 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	D	protein	474	Mus musculus	P22723 (AlphaFold model)
Heavy Chain of 8E3 Fab	H	protein	223	Mus musculus
Light Chain of 8E3 Fab	L	protein	213	Mus musculus
Gamma-aminobutyric acid receptor subunit alpha-3	C	protein	492	Mus musculus	P26049 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8G5G_1 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 2 (B, E), FASTA

>8G5G_2 Gamma-aminobutyric acid receptor subunit beta-2 (chains B, E)
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
FYKDIKQNGTQYRSLWDPTGDLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD
LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN

Sequence of entity 3 (D), FASTA

>8G5G_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSIGSSVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKD
CASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 4 (H), FASTA

>8G5G_4 Heavy Chain of 8E3 Fab (chains H)
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNMYWVKQSHGKSLEWIGYIDPYNADTTY
NREFKGKATLTVDKSSSTAFMHLNSLTSEDSAVYYCARKRNNFYFDYWGQGTPLTVSSAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKSAALEVLFQ

Sequence of entity 5 (L), FASTA

>8G5G_5 Light Chain of 8E3 Fab (chains L)
YIVMTQSPKSMSMSLGERVTLSCRASEYVGSYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFAGSGSATDFTLTITSVQAEDLADYHCGQTYNYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 6 (C), FASTA

>8G5G_6 Gamma-aminobutyric acid receptor subunit alpha-3 (chains C)
MIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVIYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISKSAA
APSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ

Ligands and cofactors

ID	Name	Formula	Copies
R5R	Zolpidem	C19 H21 N3 O	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
Y4B	allopregnanolone	C21 H34 O2	1
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2

Primary citation

Cryo-EM structures reveal native GABA A receptor assemblies and pharmacology. Sun, C., Zhu, H., Clark, S. et al. Nature (2023) 622:195-201. DOI 10.1038/s41586-023-06556-w · PubMed

Other PDB entries of the same protein (UniProt P62812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FOI 2.5 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
8G4X 2.56 Å, Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in…
8G5F 2.64 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
8G4N 2.67 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
5OSA 2.75 Å, GLIC-GABAAR alpha1 chimera crystallized at pH4.6
8G5H 2.89 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
8G4O 3.06 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
5OSC 3.1 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with pregnenolone sulfate at pH 4.5
5OSB 3.8 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with THDOC at pH4.5

Browse structure collections

About this viewer

MolViewer shows 8G5G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.